Dataset for protein classical BH3-containing proteins of organism Poecilia formosa

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A087X8P8_BAD-01      MDAKFTISDSDSEPSEDVEE------RGNLQLMQVKER------PLSQRH
A0A096LRV0_BMF-01      ----------MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALH
                                  .: .:** *      *  :. :: ::*      * .  *

A0A087X8P8_BAD-01      TLTLPELRSTTGRVRLNSESIASTISREEELQARGEEEVGTPTEGFPFRG
A0A096LRV0_BMF-01      NGMLPCGVAEEPR-RLFYGNAGFRLHFPAHFELVGDFDARQQEEQNRMEQ
                       .  **   :   * **   . .  :     ::  *: :.    *   :  

A0A087X8P8_BAD-01      RSNSAPPSLWAAKKYGRQLRRMSDEFVNLLDKGEMRKVSSTGSNRPIHHS
A0A096LRV0_BMF-01      LPLHQPAALSLEACIGQKLQLIGDQF----HREHLQQYQQNQRNQ----G
                        .   *.:*      *.:*. :.*:*     .  :.: ...  *.    .

A0A087X8P8_BAD-01      RSWW-------SYLFSHQETEGENNHHENHASRTE
A0A096LRV0_BMF-01      PLWWRMTAALLSLLFHRGFIAGGGGAGRR------
                         **       * ** .    * ..   .      

© 1998-2018