Dataset for protein classical BH3-containing proteins of organism Pelodiscus sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7FRX2_BMF-01          ------------------------------------MDPPSYLEEDYSSL
K7GA86_BCL2L11-01      MGRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFPAPAGADSERR--
                                                           : .*:  :.:    

K7FRX2_BMF-01          DGLDDDVFHSDD-----------FGLTGQPGEMTPTGIFTQNQSYSCLLG
K7GA86_BCL2L11-01      -GLAEELLLEPDSLLFRQSLSASYSLDAGKGDQMAKQPSDLNSECDGEGG
                        ** :::: . *           :.* .  *:  ..     *.. .   *

K7FRX2_BMF-01          RFQLF------PLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVT
K7GA86_BCL2L11-01      QFQSIERPSQPQHLRPGAPTSIQTQYQDRSPVPMSCDKSTQTPSPPCQ--
                       .** :         .  .*   ::: **.:. .:* ..***    **   

K7FRX2_BMF-01          EEPQRLFYGNAGYRLHEPPVGFALNPHLQEEPREGH----------QEAR
K7GA86_BCL2L11-01      ----------------------AFNHYLSAMGKQDHASRWESPSIREDMQ
                                             *:* :*.   .:.*          :: .

K7FRX2_BMF-01          AEVQIARKLQCIADQFHRLHIQR-----HQQNRNQVWWQILLFLHNLALN
K7GA86_BCL2L11-01      PEIWIAQELRRIGDEFNASYCPRRGFLDNQAINHQIVLRLLHYIIRLIWR
                       .*:.**.:*. *.*:*:  :  *     :*  .:*:  .:* :: .*  .

K7FRX2_BMF-01          VEANRNHIGQR
K7GA86_BCL2L11-01      MQ---------
                       ::         

© 1998-2018