Dataset for protein classical BH3-containing proteins of organism Paramormyrops kingsleyae

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3RH63_BMF-01       MDDDDDDVFHTDPLTYQPPFRDIKCENRGT---QTPGPALVQGLNM----
A0A3B3QC78_BCL2L11      ----------MGQILLTIPCSVCSAEDKITRMAESRNP-VAEQTPIQAGP
A0A3B3QX41_BAD-01       ----------MSGVTMAHMFTISGNESDTS---ESDTPDVTANSQLGNNL
                                   . :           *.  :   ::  * :.    :    

A0A3B3RH63_BMF-01       ----LPCGVGQEPRRLFYGSAGLRLHFPALSV-------------PGGHP
A0A3B3QC78_BCL2L11      RTAKVPGQLQATPRFSTLSASSSGYHSLDISL---------------PNS
A0A3B3QX41_BAD-01       KNTKNPGEAGGRVRMRSESQVSS-IRSEDLDFGEGGASEEGGGVCPGDGT
                             *       *    .  .   .   :..                 .

A0A3B3RH63_BMF-01       PQEERQPDDR-----------------------PQPSAEVRIGQKLQMIG
A0A3B3QC78_BCL2L11      PFMTHNKSTQTPSPSNHLVCIYLSSVTRTLSMLPDMRPEMLVARELRRIG
A0A3B3QX41_BAD-01       PFRGRSRSAP-----------------------PALWAAQRYGRQLRRMS
                        *   .. .                         *   .    ..:*. :.

A0A3B3RH63_BMF-01       DQFHQ---DQLQLYHRNQRNQQPVWWRLVMALCGLLFERRQRAEQR----
A0A3B3QC78_BCL2L11      DKFNDIYINGVSILLCPHCPLRPTAMGQGATLTPYPGDNKNKESPLRSRS
A0A3B3QX41_BAD-01       DEFDTLLDKGMKRVRSAGAARQ---MQASPSWFAFLWSHKESDAEISGSL
                        *:*     . :.         .        :      ...:         

A0A3B3RH63_BMF-01       ----------------
A0A3B3QC78_BCL2L11      SWLHVRMGEVEQQEIV
A0A3B3QX41_BAD-01       STADSRAAQ-------
                                        

© 1998-2019