Dataset for protein Noxa of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MPU8_PMAIP1-      MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHFTRSKKLVS
A0A096MPU8_PMAIP1-      MPGKKARKNAQPSPTRAQA-------------------------------
                        *******************                               

A0A096MPU8_PMAIP1-      SSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRN
A0A096MPU8_PMAIP1-      ----------ELEVECATQLRRFGDKLNFRQK---------------LLN
                                  * :*: * .   :. :  :**.               * *

A0A096MPU8_PMAIP1-      LTASKTCIGGLQKRLFLRRCTLHQFEERLHCNW
A0A096MPU8_PMAIP1-      LIAKLFCSGT-----------------------
                        * *.  * *                        

© 1998-2018