Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      -------------------------IKFGVGSARACPCQVPRASSATWVP
A0A096NTE9_BMF-03       ---------------------------------MEPSRCVE---------
A0A096NTE9_BMF-01       ---------------------------------MEPSRCVE---------
A0A096NTE9_BMF-02       ---------------------------------MEPSRCVE---------
A0A096N944_HRK-01       ------------------------MCPCPLHRGRGPPAVCACSAGRLGLR
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A2I3M6I1_BCL2L11      -------------------------------MAKQPSDVSSEC-------
A0A096NKG5_BIK-01       MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2I3MCN5_BAD-01       -----------------------MFQIPEFEPSEQEDSSSAERGLGP---
A0A2I3MCN5_BAD-04       -----------------------MFQIPEFEPSEQEDSRSAERGLGP---
A0A2I3MCN5_BAD-03       -----------------------MFQIPEFEPSEQEDSRSAERGLGP---
A0A2I3MCN5_BAD-02       -----------------------MFQIPEFEPSEQEDSSSAERGLGP---
                                                                          

A0A096MPU8_PMAIP1-      ------------MPGKKARKNAQPSPTRA---------------------
A0A2I3N2Z9_BBC3-03      CQICGPQPSLLLAEQHLESPVPSAPGALA---------------------
A0A096NTE9_BMF-03       -----------ELEDDVFQPEDGEPGAQP---------------------
A0A096NTE9_BMF-01       -----------ELEDDVFQPEDGEPGAQP---------------------
A0A096NTE9_BMF-02       -----------ELEDDVFQPEDGEPGAQP---------------------
A0A096N944_HRK-01       SSAAQLTAARLKALGDELHQRTMWRRRAR---------------------
A0A096MPU8_PMAIP1-      ------------MPGKKARKNAQPSPTRA---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A2I3M6I1_BCL2L11      -----------DREGRQLQPAERPPQLRP---------------------
A0A096NKG5_BIK-01       MEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDI
A0A2I3MCN5_BAD-01       -----------SPAGDKPSDSGKHHRQAP-----------GLLWDASHQQ
A0A2I3MCN5_BAD-04       -----------SPAGDKPSDSGKHHRQAP-----------GLLWDASHQQ
A0A2I3MCN5_BAD-03       -----------SPAGDKPSDSGKHHRQAP-----------GLLWDASHQQ
A0A2I3MCN5_BAD-02       -----------SPAGDKPSDSGKHHRQAP-----------GLLWDASHQQ
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      ----------GGPTQAAPGVRGEEEQWAREIG---------------AQL
A0A096NTE9_BMF-03       ----------GSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQE
A0A096NTE9_BMF-01       ----------GSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQE
A0A096NTE9_BMF-02       ----------GSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQE
A0A096N944_HRK-01       --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------QAGQAGTAGTAR----DQAGFGIGMQLHFT
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQ-----------------------------
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQ-----------------------------
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQ-----------------------------
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQ-----------------------------
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAP
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAP
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAP
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAP
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAP
A0A2I3M6I1_BCL2L11      ----------GAPTSLQTEPQGNPEGNHGGEG----DSCPHGSPQGPLAP
A0A096NKG5_BIK-01       RDVLRSFMDGFT--------------------------------------
A0A2I3MCN5_BAD-01       EQPTSSSHHGGA---GAVETRSRHSSYPAGTE----EDEGMEEEPSPFRG
A0A2I3MCN5_BAD-04       EQPTSSSHHGGA---GAVETRSRHSSYPAGTE----EDEGMEEEPSPFRG
A0A2I3MCN5_BAD-03       EQPTSSSHHGGT---SSPEERGHSDADAAKLQ----LDASLPVLVGSELG
A0A2I3MCN5_BAD-02       EQPTSSSHHGGRAWYSPSWESEDSENPSARML----AEASAPMSAP----
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------QAELEVECATQL
A0A2I3N2Z9_BBC3-03      RRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEME
A0A096NTE9_BMF-03       DKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL----
A0A096NTE9_BMF-01       DKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPI
A0A096NTE9_BMF-02       DKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPI
A0A096N944_HRK-01       ----------------------------------SRRAPAPGALPTYWPW
A0A096MPU8_PMAIP1-      RSKKLVSSSPLALPRGHEEQVQVARSRVCYSTQEIWR---------QTEL
A0A2I3M6I1_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2I3M6I1_BCL2L11      PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A096NKG5_BIK-01       ---------------------TLRENIMRFWRSPNPR-------------
A0A2I3MCN5_BAD-01       RSRSAP-PNLWAAQRYGRELRRMSDEFVDSFKKGLPR---PKSAGTATQM
A0A2I3MCN5_BAD-04       RSRSAP-PNLWAAQRYGRELRRMSDEFVDSF-KGLPR---PKSAGTATQM
A0A2I3MCN5_BAD-03       QGKLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRG-------
A0A2I3MCN5_BAD-02       -----------ATDSEAQHAENVKLKALGLWRRGVATAPTPRGRRRTKGW
                                                                          

A0A096MPU8_PMAIP1-      RRFGDKLNFRQKLLNLIAKLFCSGT-------------------------
A0A2I3N2Z9_BBC3-03      PN------------------------------------------------
A0A096NTE9_BMF-03       -PAQPCFEWRR---------------------------------------
A0A096NTE9_BMF-01       GEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLF
A0A096NTE9_BMF-02       GEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLF
A0A096N944_HRK-01       LCAAAQVAALAAWLLGRRNL------------------------------
A0A096MPU8_PMAIP1-      PAETSESDSQTLLLRNLTASKTCIGGLQKRLFLRRCTLHQFEERLHCNW-
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAM----DEATGSSLGIAL-----------HREVQW
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMVVILEDIGDSSLWFGFIFTGLDLYGHHHSQDTE
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMVREIEEVVV------------------------
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMGIFE-----------------------------
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMANWD-----------------------------
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A2I3M6I1_BCL2L11      PSPPC--QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYA
A0A096NKG5_BIK-01       ----SWVSREQVLLALLLLLALLLALLSGGLHLLLK--------------
A0A2I3MCN5_BAD-01       RQSSSWTRVFQSWWDRNLGRGSSAPSQ-----------------------
A0A2I3MCN5_BAD-04       RQSSSWTRVFQSWWDRNLGRGSSAPSQ-----------------------
A0A2I3MCN5_BAD-03       ---------------------SVLPLSVGGLTQIPFRCM-----------
A0A2I3MCN5_BAD-02       RRSPAPFGAARAPRPPTSGQHSVMAASSGG--------------------
                                                                          

A0A096MPU8_PMAIP1-      ----------------------------------------
A0A2I3N2Z9_BBC3-03      ----------------------------------------
A0A096NTE9_BMF-03       --------EQERGGP-------------------------
A0A096NTE9_BMF-01       LHNLALNGEENRNGVDPRYKNARRSVRKLKASSFLSCQPE
A0A096NTE9_BMF-02       LHNLALNGEENRNGVDPRPLTWNGAV----------VKPC
A0A096N944_HRK-01       ----------------------------------------
A0A096MPU8_PMAIP1-      ----------------------------------------
A0A2I3M6I1_BCL2L11      PLEWLASS--------------------------------
A0A2I3M6I1_BCL2L11      QLNHKDFS--------------------------------
A0A2I3M6I1_BCL2L11      RRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH------
A0A2I3M6I1_BCL2L11      RRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH------
A0A2I3M6I1_BCL2L11      RRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH------
A0A2I3M6I1_BCL2L11      ----------------------------------------
A0A2I3M6I1_BCL2L11      ----------------------------------------
A0A2I3M6I1_BCL2L11      ----------------------------------------
A0A2I3M6I1_BCL2L11      RRMSLPPD--------------------------------
A0A2I3M6I1_BCL2L11      RRLEK-----------------------------------
A0A096NKG5_BIK-01       ----------------------------------------
A0A2I3MCN5_BAD-01       ----------------------------------------
A0A2I3MCN5_BAD-04       ----------------------------------------
A0A2I3MCN5_BAD-03       ----------------------------------------
A0A2I3MCN5_BAD-02       ----------------------------------------
                                                                

© 1998-2019