Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MPU8_PMAIP1-      MPGKKARKNAQPSPTRAQAEL-----------------------------
A0A096NKG5_BIK-01       ----MSGVRPISRDILMETLLYEQLLEPLTME----------------VL
A0A2I3MCN5_BAD-03       ----MFQIPEFEPSEQEDSRSAERGLGPSPAGDKPSDSGKHHRQAPGLLW
A0A2I3MCN5_BAD-02       ----MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLW
A0A2I3MCN5_BAD-01       ----MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLW
A0A2I3MCN5_BAD-04       ----MFQIPEFEPSEQEDSRSAERGLGPSPAGDKPSDSGKHHRQAPGLLW
A0A096N944_HRK-01       MCPCPLHRGRGPPAV---CACSAGRLGLRS-------------SAAQLTA
A0A096MPU8_PMAIP1-      MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHFTRSKKLVS
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3M6I1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAE-------------RPPQLRP
A0A2I3N2Z9_BBC3-03      -----------------------IKFGVGSARACP---------------
A0A096NTE9_BMF-03       ---------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLD
A0A096NTE9_BMF-02       ---------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLD
A0A096NTE9_BMF-01       ---------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLD
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096NKG5_BIK-01       GVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
A0A2I3MCN5_BAD-03       DASHQQEQPTSSSHHGGTSSPEERGHSDADAA--KLQLDASLPVLVGSEL
A0A2I3MCN5_BAD-02       DASHQQEQPTSSSHHGG---------RAWYSP--SWESEDS--ENPSARM
A0A2I3MCN5_BAD-01       DASHQQEQPTSSSHHGGAGAVETRSRHSSYPA--GTEEDEGMEEEPSPFR
A0A2I3MCN5_BAD-04       DASHQQEQPTSSSHHGGAGAVETRSRHSSYPA--GTEEDEGMEEEPSPFR
A0A096N944_HRK-01       ARLKALGDELH---------------------------------------
A0A096MPU8_PMAIP1-      SSPLAL---PRGHEEQVQVARSRVC-------------------------
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQ---------------------------------------
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQ---------------------------------------
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQ---------------------------------------
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQ---------------------------------------
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2I3M6I1_BCL2L11      GAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
A0A2I3N2Z9_BBC3-03      CQVPR---------------------------------------------
A0A096NTE9_BMF-03       CPLSRLQLFPLTHCCGPGLRPTSQE-------------------------
A0A096NTE9_BMF-02       CPLSRLQLFPLTHCCGPGLRPTSQE-------------------------
A0A096NTE9_BMF-01       CPLSRLQLFPLTHCCGPGLRPTSQE-------------------------
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096NKG5_BIK-01       S--------------------EVAMHSLGLAFIYDQTDDIRDVLRSFMDG
A0A2I3MCN5_BAD-03       G--------------------QGKLRPLPVTFA-----------------
A0A2I3MCN5_BAD-02       L--------------------AEASAPMSAPATDSEAQHAENVKLKALGL
A0A2I3MCN5_BAD-01       G--------------------RSRSAPPNLWAAQRYGRELRRMSDEFVDS
A0A2I3MCN5_BAD-04       G--------------------RSRSAPPNLWAAQRYGRELRRMSDEFVDS
A0A096N944_HRK-01       ------------------------QRTMWRRRARSRRAPAPGALPTYWPW
A0A096MPU8_PMAIP1-      ----------------------YSTQEIWRQTELPAETSESDSQTLLLRN
A0A2I3M6I1_BCL2L11      ---------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      ---------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      ---------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      ---------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3M6I1_BCL2L11      IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSA
A0A2I3N2Z9_BBC3-03      --------------------------------ASSATWVPCQICGPQPSL
A0A096NTE9_BMF-03       ---------------------DKATQTLGPASPSQGVMLPCGVTEEPQRL
A0A096NTE9_BMF-02       ---------------------DKATQTLGPASPSQGVMLPCGVTEEPQRL
A0A096NTE9_BMF-01       ---------------------DKATQTLGPASPSQGVMLPCGVTEEPQRL
                                                                          

A0A096MPU8_PMAIP1-      ---------------------EVECATQLRRFGDKLNFRQKLLNLIAKLF
A0A096NKG5_BIK-01       F-------------------------TTLRENIMRFWRSPNPRSWVSREQ
A0A2I3MCN5_BAD-03       -----PRPETPPALT------VLVGHLGYGR--KCFPQALCKRGSVLPLS
A0A2I3MCN5_BAD-02       WRRGVA---TAPTPR------GRRRTKGWRRSPAPFGAARAPRPPTSGQH
A0A2I3MCN5_BAD-01       FKKGLPRPKSAGTAT------QMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
A0A2I3MCN5_BAD-04       F-KGLPRPKSAGTAT------QMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
A0A096N944_HRK-01       L-CAAAQVAALAAWL------LGRRNL-----------------------
A0A096MPU8_PMAIP1-      L-TASKTCIGGLQKR------LFLRRCTLHQFEERLHCNW----------
A0A2I3M6I1_BCL2L11      M-DEAT--------------------------GSSLGIALHREVQWPLEW
A0A2I3M6I1_BCL2L11      M-VVILEDIGDSSLW------FGFIFTGLDLYGHHHSQDTEQLNHKDFS-
A0A2I3M6I1_BCL2L11      M-ASRRQAEPADMRP------EIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2I3M6I1_BCL2L11      M-ASRRQAEPADMRP------EIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2I3M6I1_BCL2L11      M-VREIEEVVV---------------------------------------
A0A2I3M6I1_BCL2L11      M-ANWD--------------------------------------------
A0A2I3M6I1_BCL2L11      M-GIFE--------------------------------------------
A0A2I3M6I1_BCL2L11      M-ASRRQAEPADMRP------EIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2I3M6I1_BCL2L11      M-ASRRQAEPADMRP------EIRIAQELRRIGDEFNAYYARRLEK----
A0A2I3M6I1_BCL2L11      M-ASRRQAEPADMRP------EIRIAQELRRIGDEFNAYYARRMSLPPD-
A0A2I3N2Z9_BBC3-03      LLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADD
A0A096NTE9_BMF-03       FYAPAEPKSRVVADP------PL-----PAQPCFEWRR------------
A0A096NTE9_BMF-02       FYGNAGYRLPLPASF------PAVLPIGEQPPEGQWQHRAEVQIARKLQC
A0A096NTE9_BMF-01       FYGNAGYRLPLPASF------PAVLPIGEQPPEGQWQHRAEVQIARKLQC
                                                                          

A0A096MPU8_PMAIP1-      CSGT----------------------------------------------
A0A096NKG5_BIK-01       VLLALLLLLALLLALLSGGLHLLLK-------------------------
A0A2I3MCN5_BAD-03       VGGLTQIPFRCM--------------------------------------
A0A2I3MCN5_BAD-02       SVMAASSGG-----------------------------------------
A0A2I3MCN5_BAD-01       --------------------------------------------------
A0A2I3MCN5_BAD-04       --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2I3M6I1_BCL2L11      LASS----------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2I3M6I1_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH-------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      LNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPE--------
A0A096NTE9_BMF-03       -----------------------------------EQERGGP--------
A0A096NTE9_BMF-02       IADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGVDPRPLTWN
A0A096NTE9_BMF-01       IADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGVDPRYKNAR
                                                                          

A0A096MPU8_PMAIP1-      -----------------
A0A096NKG5_BIK-01       -----------------
A0A2I3MCN5_BAD-03       -----------------
A0A2I3MCN5_BAD-02       -----------------
A0A2I3MCN5_BAD-01       -----------------
A0A2I3MCN5_BAD-04       -----------------
A0A096N944_HRK-01       -----------------
A0A096MPU8_PMAIP1-      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3M6I1_BCL2L11      -----------------
A0A2I3N2Z9_BBC3-03      -------------MEPN
A0A096NTE9_BMF-03       -----------------
A0A096NTE9_BMF-02       GAV----------VKPC
A0A096NTE9_BMF-01       RSVRKLKASSFLSCQPE
                                         

© 1998-2019