Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096N944_HRK-01       -----------------------------MCPCPLHRGR-----------
A0A096MPU8_PMAIP1-      ------------------------------------MPGKKARKNAQP--
A0A096NKG5_BIK-01       MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPM-EDFDPLE
A0A2I3MCN5_BAD-01       -----------------------MFQIPEFEPSEQEDSSSAE-RGLGP--
A0A2I3MCN5_BAD-04       -----------------------MFQIPEFEPSEQEDSRSAE-RGLGP--
A0A2I3MCN5_BAD-03       -----------------------MFQIPEFEPSEQEDSRSAE-RGLGP--
A0A2I3MCN5_BAD-02       -----------------------MFQIPEFEPSEQEDSSSAE-RGLGP--
A0A096NTE9_BMF-01       -----------------------------MEPSRCVEELEDD--VFQPED
A0A096NTE9_BMF-02       -----------------------------MEPSRCVEELEDD--VFQPED
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A2I3M6I1_BCL2L11      ---------------------------MAKQPSDVSSECDREGRQLQPAE
A0A096NTE9_BMF-03       -----------------------------MEPSRCVEELEDD--VFQPED
A0A2I3N2Z9_BBC3-03      -IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQH--LESPVP
                                                                          

A0A096MPU8_PMAIP1-      -----------------MPGKKARKNAQPS--------------------
A0A096N944_HRK-01       ------------GPPAVCACSAGRLGLRSS--------------------
A0A096MPU8_PMAIP1-      ------------SPTRAQAGQAGTAGTARD---QAGFGIGMQLHFTRSKK
A0A096NKG5_BIK-01       CMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDD
A0A2I3MCN5_BAD-01       ------------SPAGDKPSDSGKHHRQAP-----------GLLWDASHQ
A0A2I3MCN5_BAD-04       ------------SPAGDKPSDSGKHHRQAP-----------GLLWDASHQ
A0A2I3MCN5_BAD-03       ------------SPAGDKPSDSGKHHRQAP-----------GLLWDASHQ
A0A2I3MCN5_BAD-02       ------------SPAGDKPSDSGKHHRQAP-----------GLLWDASHQ
A0A096NTE9_BMF-01       ------------GEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCG
A0A096NTE9_BMF-02       ------------GEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCG
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQ--------------------
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQ--------------------
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQ--------------------
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQ--------------------
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQGNPEGNHGGEG----DSCPH
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQGNPEGNHGGEG----DSCPH
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQGNPEGNHGGEG----DSCPH
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQGNPEGNHGGEG----DSCPH
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQGNPEGNHGGEG----DSCPH
A0A2I3M6I1_BCL2L11      ------------RPPQLRPGAPTSLQTEPQGNPEGNHGGEG----DSCPH
A0A096NTE9_BMF-03       ------------GEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCG
A0A2I3N2Z9_BBC3-03      ------------SAPGALAGGPTQA------------------------A
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------AAQLTAARLKAL
A0A096MPU8_PMAIP1-      LVSSSPLALPRGH--------------------------------EEQVQ
A0A096NKG5_BIK-01       IRDVLRSFMDGFT-------------------------------------
A0A2I3MCN5_BAD-01       QEQPTSSSHHGGA---GAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSR
A0A2I3MCN5_BAD-04       QEQPTSSSHHGGA---GAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSR
A0A2I3MCN5_BAD-03       QEQPTSSSHHGGT---SSPEERGHSDADAAKLQLDASLPVLVGSELGQGK
A0A2I3MCN5_BAD-02       QEQPTSSSHHGGRAWYSPSWESEDSENPSARMLAEASAPMSAP-------
A0A096NTE9_BMF-01       PGLRPTSQEDKAT-------QTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A096NTE9_BMF-02       PGLRPTSQEDKAT-------QTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      GSPQGPLAPPASP-------GPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3M6I1_BCL2L11      GSPQGPLAPPASP-------GPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3M6I1_BCL2L11      GSPQGPLAPPASP-------GPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3M6I1_BCL2L11      GSPQGPLAPPASP-------GPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3M6I1_BCL2L11      GSPQGPLAPPASP-------GPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3M6I1_BCL2L11      GSPQGPLAPPASP-------GPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A096NTE9_BMF-03       PGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVV
A0A2I3N2Z9_BBC3-03      PGVR--GEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVL
                                                                          

A0A096MPU8_PMAIP1-      PTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT---------
A0A096N944_HRK-01       GDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRN
A0A096MPU8_PMAIP1-      VARSRVCYSTQEIWRQ-TELPAETSESDSQTLLLRNLTASKTCIGGLQKR
A0A096NKG5_BIK-01       ------------------TLRENIMRFWRSPNPR----------------
A0A2I3MCN5_BAD-01       SAP-PNLWAAQRYGRELRRMSDEFVDSFKKGLPR---PKSAGTATQMRQS
A0A2I3MCN5_BAD-04       SAP-PNLWAAQRYGRELRRMSDEFVDSF-KGLPR---PKSAGTATQMRQS
A0A2I3MCN5_BAD-03       LRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRG----------
A0A2I3MCN5_BAD-02       --------ATDSEAQHAENVKLKALGLWRRGVATAPTPRGRRRTKGWRRS
A0A096NTE9_BMF-01       GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A096NTE9_BMF-02       GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2I3M6I1_BCL2L11      -DRSPAPMSCDKSTQT-PSPPCQAFNHYLSAM----DEATGSSLGIAL--
A0A2I3M6I1_BCL2L11      -DRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMVVILEDIGDSSLWFGFIF
A0A2I3M6I1_BCL2L11      -DRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIA
A0A2I3M6I1_BCL2L11      -DRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIA
A0A2I3M6I1_BCL2L11      TDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIA
A0A2I3M6I1_BCL2L11      TDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMVREIEEVVV---------
A0A2I3M6I1_BCL2L11      TDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMGIFE--------------
A0A2I3M6I1_BCL2L11      TDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMANWD--------------
A0A2I3M6I1_BCL2L11      TDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIA
A0A2I3M6I1_BCL2L11      TDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIA
A0A096NTE9_BMF-03       ADPPLPAQPCFEWRREQERGGP----------------------------
A0A2I3N2Z9_BBC3-03      YNLIMGLLPLPRGHRAPEMEPN----------------------------
                                                                          

A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A096N944_HRK-01       L-------------------------------------------------
A0A096MPU8_PMAIP1-      LFLRRCTLHQFEERLHCNW-------------------------------
A0A096NKG5_BIK-01       -SWVSREQVLLALLLLLALLLALLSGGLHLLLK-----------------
A0A2I3MCN5_BAD-01       SSWTRVFQSWWDRNLGRGSSAPSQ--------------------------
A0A2I3MCN5_BAD-04       SSWTRVFQSWWDRNLGRGSSAPSQ--------------------------
A0A2I3MCN5_BAD-03       ------------------SVLPLSVGGLTQIPFRCM--------------
A0A2I3MCN5_BAD-02       PAPFGAARAPRPPTSGQHSVMAASSGG-----------------------
A0A096NTE9_BMF-01       QHQQNRNRVWWQILLFLHNLALNGEENRNGVDPRYKNARRSVRKLKASSF
A0A096NTE9_BMF-02       QHQQNRNRVWWQILLFLHNLALNGEENRNGVDPRPLTWNGAV--------
A0A2I3M6I1_BCL2L11      ---------HREVQWPLEWLASS---------------------------
A0A2I3M6I1_BCL2L11      TGLDLYGHHHSQDTEQLNHKDFS---------------------------
A0A2I3M6I1_BCL2L11      QELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH-
A0A2I3M6I1_BCL2L11      QELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH-
A0A2I3M6I1_BCL2L11      QELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH-
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      QELRRIGDEFNAYYARRMSLPPD---------------------------
A0A2I3M6I1_BCL2L11      QELRRIGDEFNAYYARRLEK------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
                                                                          

A0A096MPU8_PMAIP1-      ------
A0A096N944_HRK-01       ------
A0A096MPU8_PMAIP1-      ------
A0A096NKG5_BIK-01       ------
A0A2I3MCN5_BAD-01       ------
A0A2I3MCN5_BAD-04       ------
A0A2I3MCN5_BAD-03       ------
A0A2I3MCN5_BAD-02       ------
A0A096NTE9_BMF-01       LSCQPE
A0A096NTE9_BMF-02       --VKPC
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A2I3M6I1_BCL2L11      ------
A0A096NTE9_BMF-03       ------
A0A2I3N2Z9_BBC3-03      ------
                              

© 1998-2019