Dataset for protein Bmf of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NTE9_BMF-03      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A096NTE9_BMF-02      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A096NTE9_BMF-01      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A096NTE9_BMF-03      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA
A0A096NTE9_BMF-02      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A096NTE9_BMF-01      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
                       ***********************************************. *

A0A096NTE9_BMF-03      EPKSRVVADPPL-----PAQPCFEWRR-----------------------
A0A096NTE9_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A096NTE9_BMF-01      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
                         .  : *. *         *  :*..                       

A0A096NTE9_BMF-03      ------------------------EQERGGP-------------------
A0A096NTE9_BMF-02      QHQQNRNRVWWQILLFLHNLALNGEENRNGVDPRPLTWNGAV--------
A0A096NTE9_BMF-01      QHQQNRNRVWWQILLFLHNLALNGEENRNGVDPRYKNARRSVRKLKASSF
                                               *::*.*                    

A0A096NTE9_BMF-03      ------
A0A096NTE9_BMF-02      --VKPC
A0A096NTE9_BMF-01      LSCQPE
                             

© 1998-2018