Dataset for protein Bad of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3MCN5_BAD-03      MFQIPEFEPSEQEDSRSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
A0A2I3MCN5_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
A0A2I3MCN5_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
A0A2I3MCN5_BAD-04      MFQIPEFEPSEQEDSRSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
                       *************** **********************************

A0A2I3MCN5_BAD-03      QQEQPTSSSHHGGTSSPEERGHSDADAAKLQLDASLPVLVGSELGQGKLR
A0A2I3MCN5_BAD-02      QQEQPTSSSHHGG---------RAWYSPSWESEDS--ENPSARMLAEASA
A0A2I3MCN5_BAD-01      QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
A0A2I3MCN5_BAD-04      QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
                       *************             ..  : : .     ..        

A0A2I3MCN5_BAD-03      PLPVTFA----------------------PRPETPPALTVLVGHLGYGR-
A0A2I3MCN5_BAD-02      PMSAPATDSEAQHAENVKLKALGLWRRGVA---TAPTPRGRRRTKGWRRS
A0A2I3MCN5_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV
A0A2I3MCN5_BAD-04      PPNLWAAQRYGRELRRMSDEFVDSF-KGLPRPKSAGTATQMRQSSSWTRV
                       *     :                      .   :. :        .: * 

A0A2I3MCN5_BAD-03      -KCFPQALCKRGSVLPLSVGGLTQIPFRCM
A0A2I3MCN5_BAD-02      PAPFGAARAPRPPTSGQHSVMAASSGG---
A0A2I3MCN5_BAD-01      FQSWWDRNLGRGSSAPSQ------------
A0A2I3MCN5_BAD-04      FQSWWDRNLGRGSSAPSQ------------
                          :      * .                 

© 1998-2018