Dataset for protein Bad of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3MCN5_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
A0A2I3MCN5_BAD-04      MFQIPEFEPSEQEDSRSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
A0A2I3MCN5_BAD-03      MFQIPEFEPSEQEDSRSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
A0A2I3MCN5_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDKPSDSGKHHRQAPGLLWDASH
                       *************** **********************************

A0A2I3MCN5_BAD-01      QQEQPTSSSHHGGA---GAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRS
A0A2I3MCN5_BAD-04      QQEQPTSSSHHGGA---GAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRS
A0A2I3MCN5_BAD-03      QQEQPTSSSHHGGT---SSPEERGHSDADAAKLQLDASLPVLVGSELGQG
A0A2I3MCN5_BAD-02      QQEQPTSSSHHGGRAWYSPSWESEDSENPSARMLAEASAPMSAP------
                       *************    ..       .  .*    : .            

A0A2I3MCN5_BAD-01      RSAP-PNLWAAQRYGRELRRMSDEFVDSFKKGLPR---PKSAGTATQMRQ
A0A2I3MCN5_BAD-04      RSAP-PNLWAAQRYGRELRRMSDEFVDSF-KGLPR---PKSAGTATQMRQ
A0A2I3MCN5_BAD-03      KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRG---------
A0A2I3MCN5_BAD-02      ---------ATDSEAQHAENVKLKALGLWRRGVATAPTPRGRRRTKGWRR
                                *.         :    :.   . ..     ..         

A0A2I3MCN5_BAD-01      SSSWTRVFQSWWDRNLGRGSSAPSQ------------
A0A2I3MCN5_BAD-04      SSSWTRVFQSWWDRNLGRGSSAPSQ------------
A0A2I3MCN5_BAD-03      -------------------SVLPLSVGGLTQIPFRCM
A0A2I3MCN5_BAD-02      SPAPFGAARAPRPPTSGQHSVMAASSGG---------
                                          *  . .            

© 1998-2019