Dataset for protein Noxa of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLSSSL
A0A2I3SX38_PMAIP1-      MPGKKARKNAQPSPARAPA-------------------------------
                        *******************                               

A0A2I3SX38_PMAIP1-      SSWPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLR
A0A2I3SX38_PMAIP1-      -----ELEVECATQLRRFGDKLNF--------------------------
                              *      *:.  *..: :                          

A0A2I3SX38_PMAIP1-      NLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW-
A0A2I3SX38_PMAIP1-      -------------------RQKLLNLISKLFCSGT
                                           * .: :: ..*.*.  

© 1998-2018