Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
H2Q6Y8_HRK-01           ---------------------------------------MCPCPLHRGRD
A0A2J8QDD5_BMF-01       ------------------------------------------------ME
A0A2I3RGH5_BBC3-03      ---------------------------------------MKFGMGSAQAC
A0A2I3RGH5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2J8QDD5_BMF-02       ------------------------------------------------ME
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
                                                                          

A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
H2QLU7_BIK-01           -------------------------------------------MSEVRPL
A0A2I3TBK7_BAD-02       -------------------------------------------MFQIPEF
A0A2I3TBK7_BAD-03       -------------------------------------------MFQIPEF
A0A2I3TBK7_BAD-01       -------------------------------------------MFQIPEF
H2Q6Y8_HRK-01           PPAV-----------------------------------CACSAGRLGLR
A0A2J8QDD5_BMF-01       PSQCVEE----------------------------------LEDDVFQPE
A0A2I3RGH5_BBC3-03      PCQVPRA--ASATWVPCQIC---------------------GPQPSLSLA
A0A2I3RGH5_BBC3-01      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2J8QDD5_BMF-02       PSQCVEE--------------------------------LEDD--VFQPE
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
                                                                          

A0A2I3SX38_PMAIP1-      AQPSPARAPAE---------------------------------------
H2QLU7_BIK-01           SRDILMETLLY---------------------------------------
A0A2I3TBK7_BAD-02       EPSEQEDSSSA---------------------------------------
A0A2I3TBK7_BAD-03       EPSEQEDSSSA---------------------------------------
A0A2I3TBK7_BAD-01       EPSEQEDSSSA---------------------------------------
H2Q6Y8_HRK-01           SSAAQLT-------------------------------------------
A0A2J8QDD5_BMF-01       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2I3RGH5_BBC3-03      EQHLESPVPSA---------------------------------------
A0A2I3RGH5_BBC3-01      EQHLESPVPSA---------------------------------------
A0A2J8QDD5_BMF-02       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2I3SX38_PMAIP1-      AQPSPARAPAG---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2QLU7_BIK-01           -----------------EQLLEPPTME----------------VLGVTDS
A0A2I3TBK7_BAD-02       -----------------ERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQ
A0A2I3TBK7_BAD-03       -----------------ERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQ
A0A2I3TBK7_BAD-01       -----------------ERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQ
H2Q6Y8_HRK-01           -----------------AARLKALGD------------------------
A0A2J8QDD5_BMF-01       KATQTLSPASPSQGVMLPCGVTEEPQ------------------------
A0A2I3RGH5_BBC3-03      -----------------PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRM
A0A2I3RGH5_BBC3-01      -----------------PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRM
A0A2J8QDD5_BMF-02       KATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIG
A0A2I3SX38_PMAIP1-      -----------------PAGTARDQAGFGIG-------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQ------------------------
                                                                          

A0A2I3SX38_PMAIP1-      ----------------------------------------LEVECATQLR
H2QLU7_BIK-01           EEDLDPMEDFD-------SLECMEGSDALALRL-------ACIGDEMDVS
A0A2I3TBK7_BAD-02       QEQPTSSSHHGGAGAV--EIRSRHSSYPAG--------------TEDDEG
A0A2I3TBK7_BAD-03       QEQPTSSSHHGGRTSYSPSWESEDSENPSAGML-----------AEASAG
A0A2I3TBK7_BAD-01       QEQPTSSSHHGEGTS---SPEERGHSNPDAAKLQLDASLPVLVGSELGQG
H2Q6Y8_HRK-01           ------------------------------------ELHQRTMWRRRARS
A0A2J8QDD5_BMF-01       -------------------------------------RLFYAPAEPKSCV
A0A2I3RGH5_BBC3-03      ADDLNAQYERRRQE-------------------------------EQQRH
A0A2I3RGH5_BBC3-01      ADDLNAQYERRRQE-------------------------------EQQRH
A0A2J8QDD5_BMF-02       EQPPEGQWQHRAEVQIARKLQCIADQFHR-------------LHVQQHQQ
A0A2I3SX38_PMAIP1-      ----------------------MQLRFTRGKKLLSSSLSSWPLALPRGHE
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
                                                                          

A0A2I3SX38_PMAIP1-      RFGDKLNFRQKLLNLISKLFCSGT--------------------------
H2QLU7_BIK-01           LRAPRLAQLSD------------------VAMHSLGLAFIYDQTEDIRDV
A0A2I3TBK7_BAD-02       MGEEPSPFRGR------------------SRSAPPNLWAAQRYGRELRRM
A0A2I3TBK7_BAD-03       MSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRS----
A0A2I3TBK7_BAD-01       KLRPLPVTFAPHPE---------------TPPVPTALGSHLEYGRKY---
H2Q6Y8_HRK-01           RRAPAPGALPTYWPWLCAA----------AQVAALAAWLLGRRNL-----
A0A2J8QDD5_BMF-01       VADPPLPAQPCFEWRREQE----------RGRP-----------------
A0A2I3RGH5_BBC3-03      RPSPWRVLYNLIMGLLPLP----------RGHRAPEMEPN----------
A0A2I3RGH5_BBC3-01      RPSPWRVLYNLIMGLLPLP----------RGHRAPEMEPN----------
A0A2J8QDD5_BMF-02       NQNRVWWQILLFLHNLALN----------GEENRNGAGPR----------
A0A2I3SX38_PMAIP1-      EQVQVAGSRVCYSTQEIWR----------QTELPAETSESDIQTLLLRNL
A0A2J8JCT2_BCL2L11      ----------------ASM----------RQAEPADMRPEIWIAQELRRI
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMASM----------RQAEPADMRPEIWIAQELRRI
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMASM----------RQAEPADMRPEIWIAQELRRI
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMANW----------D--------------------
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMGIF----------E--------------------
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMVRE----------IEEVVV---------------
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMASM----------RQAEPADMRPEIWIAQELRRI
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMASM----------RQAEPADMRPEIWIAQELRRI
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMVVI----------LEDIGDLSLCFGFIFTGLDLY
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAM--------------DDSAGSSLRIAL--------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2QLU7_BIK-01           LRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSG
A0A2I3TBK7_BAD-02       SDEFVDSF-KKGLP-----RPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
A0A2I3TBK7_BAD-03       ----PAPFGAARAR-----RPPTSGQHSAMAASSGG--------------
A0A2I3TBK7_BAD-01       ---FPQAYAKRGSV-----LSPLEGGLTPIPFRCV---------------
H2Q6Y8_HRK-01           --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2I3SX38_PMAIP1-      TASKTCMRGLLQKSFLRRCTFHQFEERLHCNW------------------
A0A2J8JCT2_BCL2L11      GDEFNAYYARRLAKLLASST------------------------------
A0A2J8JCT2_BCL2L11      GDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH-------
A0A2J8JCT2_BCL2L11      GDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH-------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      GDEFNAYYARRMPLPPD---------------------------------
A0A2J8JCT2_BCL2L11      GDEFNAYYARRLEK------------------------------------
A0A2J8JCT2_BCL2L11      GHHHSQDAEQLNHKDFS---------------------------------
A0A2J8JCT2_BCL2L11      ------------HREVQWPLKWLAKSS-----------------------
                                                                          

A0A2I3SX38_PMAIP1-      -------
H2QLU7_BIK-01           GLHLLLK
A0A2I3TBK7_BAD-02       GSSAPSQ
A0A2I3TBK7_BAD-03       -------
A0A2I3TBK7_BAD-01       -------
H2Q6Y8_HRK-01           -------
A0A2J8QDD5_BMF-01       -------
A0A2I3RGH5_BBC3-03      -------
A0A2I3RGH5_BBC3-01      -------
A0A2J8QDD5_BMF-02       -------
A0A2I3SX38_PMAIP1-      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
A0A2J8JCT2_BCL2L11      -------
                               

© 1998-2019