Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       ------------------------------------------------ME
A0A2J8QDD5_BMF-02       ------------------------------------------------ME
H2Q6Y8_HRK-01           ----------------------------------------------MCPC
A0A2I3RGH5_BBC3-03      ---------------------------------------MKFGMGSAQAC
A0A2I3RIG5_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
                                                                          

A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
H2QLU7_BIK-01           ----------------------------------------MSEVRPLSRD
A0A2I3TBK7_BAD-01       ----------------------------------------MFQIPEFEPS
A0A2I3TBK7_BAD-03       ----------------------------------------MFQIPEFEPS
A0A2I3TBK7_BAD-02       ----------------------------------------MFQIPEFEPS
A0A2J8QDD5_BMF-01       PSQCVEE----------------------------------LEDDVFQPE
A0A2J8QDD5_BMF-02       PSQCVEE----------------------------------LEDDVFQPE
H2Q6Y8_HRK-01           PLHRGRD----------------------------PPAVCACSAGRLGLR
A0A2I3RGH5_BBC3-03      PCQVPRA--ASATWVPCQIC---------------------GPQPSLSLA
A0A2I3RIG5_BBC3-02      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
                                                                          

A0A2I3SX38_PMAIP1-      AQPSPARAPAE---------------------------------------
H2QLU7_BIK-01           ILMETLLYEQLLE--------------------PPTME------------
A0A2I3TBK7_BAD-01       EQEDSSSAERGLG--------------------PSPAGDGPSGSGKHHRQ
A0A2I3TBK7_BAD-03       EQEDSSSAERGLG--------------------PSPAGDGPSGSGKHHRQ
A0A2I3TBK7_BAD-02       EQEDSSSAERGLG--------------------PSPAGDGPSGSGKHHRQ
A0A2J8QDD5_BMF-01       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2J8QDD5_BMF-02       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
H2Q6Y8_HRK-01           SSAAQLT-AAR----------------------LKALGDELH--------
A0A2I3RGH5_BBC3-03      EQHLESPVPSA----------------------PGALAGGPTQAAPGVRG
A0A2I3RIG5_BBC3-02      EQHLESPVPSA----------------------PGALAGGPTQAAPGVRG
A0A2I3SX38_PMAIP1-      AQPSPARAPAG----------------------PAGTARDQAGFGIG---
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQ--------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQ--------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQ--------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA----------------------PTSLQTEPQ--------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2QLU7_BIK-01           ----VLGVTDSEEDLDPMEDFDS-------------LECMEGSDALALRL
A0A2I3TBK7_BAD-01       APGLLWDASHQQEQPTSSSHHGE--------------GTSSPEERGHSNP
A0A2I3TBK7_BAD-03       APGLLWDASHQQEQPTSSSHHGG---------RTSYSPSWESED--SENP
A0A2I3TBK7_BAD-02       APGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEP
A0A2J8QDD5_BMF-01       KATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCVVADPPL-----
A0A2J8QDD5_BMF-02       KATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIG
H2Q6Y8_HRK-01           --------------------------------------------------
A0A2I3RGH5_BBC3-03      EEEQWAREIGAQLRRMADDLNAQYERRRQE--------------------
A0A2I3RIG5_BBC3-02      EEEQWAREIGAQLRRMADDLNAQYERRRQE--------------------
A0A2I3SX38_PMAIP1-      --------------------------------------MQLRFTRGKKLL
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      ------LEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT----------
H2QLU7_BIK-01           ACIGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGF
A0A2I3TBK7_BAD-01       DAAKLQLDASLPVLVGSELGQGKLRPLPVTF-------AP---HPETPPV
A0A2I3TBK7_BAD-03       SAGMLAEASAGMSAPAADSEAQHAENVKLEALGLWRSGVA------TAPT
A0A2I3TBK7_BAD-02       SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLP---RPKSAGT
A0A2J8QDD5_BMF-01       --PAQPCFEWRREQERGRP-------------------------------
A0A2J8QDD5_BMF-02       EQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFL
H2Q6Y8_HRK-01           -----QRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRN
A0A2I3RGH5_BBC3-03      -----------EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN----
A0A2I3RIG5_BBC3-02      -----------EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN----
A0A2I3SX38_PMAIP1-      SSSLSSWPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQT
A0A2J8JCT2_BCL2L11      --------------------------------ASMRQAEPADMRPEIWIA
A0A2J8JCT2_BCL2L11      --DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
A0A2J8JCT2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV---------
A0A2J8JCT2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE--------------
A0A2J8JCT2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD--------------
A0A2J8JCT2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
A0A2J8JCT2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
A0A2J8JCT2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIA
A0A2J8JCT2_BCL2L11      --DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIF
A0A2J8JCT2_BCL2L11      --DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM----DDSAGSSLRIAL--
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2QLU7_BIK-01           TTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK-
A0A2I3TBK7_BAD-01       PTALGSHLEYGRKYFPQAYAKRGSVL-----------SPLEGGLTPIPFR
A0A2I3TBK7_BAD-03       PRGRRTTKGWGR--SPAPFGAARARR-----------PPTSGQHSAMAAS
A0A2I3TBK7_BAD-02       ATQMRQSSSWTR--VFQSWWDRNLGR-----------GSSAPSQ------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       HNLALNGEENRNGAGPR---------------------------------
H2Q6Y8_HRK-01           L-------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
A0A2I3SX38_PMAIP1-      LLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW------------
A0A2J8JCT2_BCL2L11      QELRRIGDEFNAYYARRLAKLLASST------------------------
A0A2J8JCT2_BCL2L11      QELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH-
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      QELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH-
A0A2J8JCT2_BCL2L11      QELRRIGDEFNAYYARRMPLPPD---------------------------
A0A2J8JCT2_BCL2L11      QELRRIGDEFNAYYARRLEK------------------------------
A0A2J8JCT2_BCL2L11      TGLDLYGHHHSQDAEQLNHKDFS---------------------------
A0A2J8JCT2_BCL2L11      ------------------HREVQWPLKWLAKSS-----------------
                                                                          

A0A2I3SX38_PMAIP1-      ---
H2QLU7_BIK-01           ---
A0A2I3TBK7_BAD-01       CV-
A0A2I3TBK7_BAD-03       SGG
A0A2I3TBK7_BAD-02       ---
A0A2J8QDD5_BMF-01       ---
A0A2J8QDD5_BMF-02       ---
H2Q6Y8_HRK-01           ---
A0A2I3RGH5_BBC3-03      ---
A0A2I3RIG5_BBC3-02      ---
A0A2I3SX38_PMAIP1-      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
A0A2J8JCT2_BCL2L11      ---
                           

© 1998-2019