Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
H2Q6Y8_HRK-01           ---------------------------------------MCPCPLHRGRD
A0A2J8QDD5_BMF-01       ------------------------------------------------ME
A0A2I3RGH5_BBC3-03      ---------------------------------------MKFGMGSAQAC
A0A2I3RIG5_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
A0A2J8QDD5_BMF-02       ------------------------------------------------ME
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
A0A2J8JCT2_BCL2L11      ----------------------------------------------MAKQ
                                                                          

A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
H2QLU7_BIK-01           ----------------------------------------MSEVRPLSRD
A0A2I3TBK7_BAD-01       ----------------------------------------MFQIPEFEPS
A0A2I3TBK7_BAD-03       ----------------------------------------MFQIPEFEPS
A0A2I3TBK7_BAD-02       ----------------------------------------MFQIPEFEPS
H2Q6Y8_HRK-01           PPAV-----------------------------------CACSAGRLGLR
A0A2J8QDD5_BMF-01       PSQCVEE----------------------------------LEDDVFQPE
A0A2I3RGH5_BBC3-03      PCQVPRA--ASATWVPCQIC---------------------GPQPSLSLA
A0A2I3RIG5_BBC3-02      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2J8QDD5_BMF-02       PSQCVEE--------------------------------LEDD--VFQPE
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
A0A2J8JCT2_BCL2L11      PSDVSSE--------------------------------CDREGRQLQPA
                                                                          

A0A2I3SX38_PMAIP1-      AQPSPARAPAE---------------------------------------
H2QLU7_BIK-01           ILMETLLYEQLLE-------------------------------------
A0A2I3TBK7_BAD-01       EQEDSSSAERGLG-------------------------------------
A0A2I3TBK7_BAD-03       EQEDSSSAERGLG-------------------------------------
A0A2I3TBK7_BAD-02       EQEDSSSAERGLG-------------------------------------
H2Q6Y8_HRK-01           SSAAQLT-------------------------------------------
A0A2J8QDD5_BMF-01       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2I3RGH5_BBC3-03      EQHLESPVPSA---------------------------------------
A0A2I3RIG5_BBC3-02      EQHLESPVPSA---------------------------------------
A0A2J8QDD5_BMF-02       DGEPVTQ-PGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQED
A0A2I3SX38_PMAIP1-      AQPSPARAPAG---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
A0A2J8JCT2_BCL2L11      ERPPQLR-PGA---------------------------------------
                                                                          

A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2QLU7_BIK-01           -----------------PPTME----------------VLGVTDSEEDLD
A0A2I3TBK7_BAD-01       -----------------PSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
A0A2I3TBK7_BAD-03       -----------------PSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
A0A2I3TBK7_BAD-02       -----------------PSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPT
H2Q6Y8_HRK-01           -----------------AARLKALGD------------------------
A0A2J8QDD5_BMF-01       KATQTLSPASPSQGVMLPCGVTEEPQ------------------------
A0A2I3RGH5_BBC3-03      -----------------PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRM
A0A2I3RIG5_BBC3-02      -----------------PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRM
A0A2J8QDD5_BMF-02       KATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIG
A0A2I3SX38_PMAIP1-      -----------------PAGTARDQAGFGIG-------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2J8JCT2_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
                                                                          

A0A2I3SX38_PMAIP1-      ----------------------------------------LEVECATQLR
H2QLU7_BIK-01           PMEDFDS-------------LECMEGSDALALRLACIGDEMDVSLRAPRL
A0A2I3TBK7_BAD-01       SSSHHGE--------------GTSSPEERGHSNPDAAKLQLDASLPVLVG
A0A2I3TBK7_BAD-03       SSSHHGG---------RTSYSPSWESED--SENPSAGMLAEASAGMSAPA
A0A2I3TBK7_BAD-02       SSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWA
H2Q6Y8_HRK-01           ------------------------------------ELHQRTMWRRRARS
A0A2J8QDD5_BMF-01       -------------------------------------RLFYAPAEPKSCV
A0A2I3RGH5_BBC3-03      ADDLNAQYERRRQE-------------------------------EQQRH
A0A2I3RIG5_BBC3-02      ADDLNAQYERRRQE-------------------------------EQQRH
A0A2J8QDD5_BMF-02       EQPPEGQWQHRAEVQIARKLQCIADQFHR-------------LHVQQHQQ
A0A2I3SX38_PMAIP1-      ----------------------MQLRFTRGKKLLSSSLSSWPLALPRGHE
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      ------------------------------------DRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2J8JCT2_BCL2L11      PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
                                                                          

A0A2I3SX38_PMAIP1-      RFGDKLNFRQKLLNLISKLFCSGT--------------------------
H2QLU7_BIK-01           AQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNP
A0A2I3TBK7_BAD-01       SELGQGKLRPLPVTF-------AP---HPETPPVPTALGSHLEYGRKYFP
A0A2I3TBK7_BAD-03       ADSEAQHAENVKLEALGLWRSGVA------TAPTPRGRRTTKGWGR--SP
A0A2I3TBK7_BAD-02       AQRYGRELRRMSDEFVDSFKKGLP---RPKSAGTATQMRQSSSWTR--VF
H2Q6Y8_HRK-01           RRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL---------------
A0A2J8QDD5_BMF-01       VADPPLPAQPCFEWRREQERGRP---------------------------
A0A2I3RGH5_BBC3-03      RPSPWRVLYNLIMGLLPLPRGHRAPEMEPN--------------------
A0A2I3RIG5_BBC3-02      RPSPWRVLYNLIMGLLPLPRGHRAPEMEPN--------------------
A0A2J8QDD5_BMF-02       NQNRVWWQILLFLHNLALNGEENRNGAGPR--------------------
A0A2I3SX38_PMAIP1-      EQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGL
A0A2J8JCT2_BCL2L11      ----------------ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAM----DDSAGSSLRIAL------------------
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHSQDAEQ
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMVREIEEVVV-------------------------
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMANWD------------------------------
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMGIFE------------------------------
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
A0A2J8JCT2_BCL2L11      TPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYAR
                                                                          

A0A2I3SX38_PMAIP1-      -------------------------------------
H2QLU7_BIK-01           GSWVSREQVLLALLLLLALLLPLLSGGLHLLLK----
A0A2I3TBK7_BAD-01       QAYAKRGSVL-----------SPLEGGLTPIPFRCV-
A0A2I3TBK7_BAD-03       APFGAARARR-----------PPTSGQHSAMAASSGG
A0A2I3TBK7_BAD-02       QSWWDRNLGR-----------GSSAPSQ---------
H2Q6Y8_HRK-01           -------------------------------------
A0A2J8QDD5_BMF-01       -------------------------------------
A0A2I3RGH5_BBC3-03      -------------------------------------
A0A2I3RIG5_BBC3-02      -------------------------------------
A0A2J8QDD5_BMF-02       -------------------------------------
A0A2I3SX38_PMAIP1-      LQKSFLRRCTFHQFEERLHCNW---------------
A0A2J8JCT2_BCL2L11      RLAKLLASST---------------------------
A0A2J8JCT2_BCL2L11      --HREVQWPLKWLAKSS--------------------
A0A2J8JCT2_BCL2L11      LNHKDFS------------------------------
A0A2J8JCT2_BCL2L11      RVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH----
A0A2J8JCT2_BCL2L11      -------------------------------------
A0A2J8JCT2_BCL2L11      -------------------------------------
A0A2J8JCT2_BCL2L11      -------------------------------------
A0A2J8JCT2_BCL2L11      RVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH----
A0A2J8JCT2_BCL2L11      RMPLPPD------------------------------
A0A2J8JCT2_BCL2L11      RLEK---------------------------------
                                                             

© 1998-2019