Dataset for protein Bmf of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2J8QDD5_BMF-02      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2J8QDD5_BMF-01      MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A2J8QDD5_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2J8QDD5_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA
                       ***********************************************. *

A0A2J8QDD5_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2J8QDD5_BMF-01      EPKSCVVADPPL-------PAQPCFEWRREQERGRP--------------
                         .  : *. *        *.:  ::.* * : .*               

A0A2J8QDD5_BMF-02      QHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2J8QDD5_BMF-01      ----------------------------------
                                                         

© 1998-2018