Dataset for protein Puma of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3RGH5_BBC3-03      ---------------------------------------MKFGMGSAQAC
A0A2I3RIG5_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAA
                                                                : *:.:* *.

A0A2I3RGH5_BBC3-03      PCQVPRA--ASATWVPCQIC---------------------GPQPSLSLA
A0A2I3RIG5_BBC3-02      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
                        *  :* *  .:.*  *.  .                     *********

A0A2I3RGH5_BBC3-03      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2I3RIG5_BBC3-02      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
                        **************************************************

A0A2I3RGH5_BBC3-03      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2I3RIG5_BBC3-02      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                        *******************************************

© 1998-2018