Dataset for protein Noxa of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9AKC9_PMAIP1-      MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFR----QKLLN--
A0A2R9AKC9_PMAIP1-      MPGKKARKNAQPSPARAPAG-PAGTARDQAGFGIGMQLRFTRGKKLLSSS
                        *******************   .  * :   **  :::*    :***.  

A0A2R9AKC9_PMAIP1-      -----------------------------------------------LIS
A0A2R9AKC9_PMAIP1-      SSSPLALPRGHEEQAQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLR
                                                                       *: 

A0A2R9AKC9_PMAIP1-      KLFCSGT---------------------------
A0A2R9AKC9_PMAIP1-      NLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW
                        :* .* *                           

© 1998-2018