Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9AKC9_PMAIP1-      -------MPGKKARKNAQPSPARAPAELEVECATQLRRFGD---------
A0A2R8ZXD2_BIK-01       -MSEVRPLSRDILMETLLYEQLLEPPTME---------------------
A0A2R8Z697_BAD-02       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQ---------
A0A2R8Z697_BAD-03       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQ---------
A0A2R8Z697_BAD-01       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQ---------
A0A2R9BS98_BMF-02       --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLD-----
A0A2R9BS98_BMF-01       --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLD-----
A0A2R9BZA9_BBC3-01      -MKFGMGSAQACPCQVPRAASVTWVPCQICGPQPSLSLAEQ---------
A0A2R9AKC9_PMAIP1-      ---MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLS
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2R9CA99_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                                                                          

A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2R8ZXD2_BIK-01       ------------VLGVTESEEDLDPMEDFDSLECME--------------
A0A2R8Z697_BAD-02       --------APGLLWDASHQQEQPTSSSHHGE--------------GTSSP
A0A2R8Z697_BAD-03       --------APGLLWDASHQQEQPTSSSHHGG---------RTSYSPSWES
A0A2R8Z697_BAD-01       --------APGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTED
A0A2R9BS98_BMF-02       -----------------------CPLSRLQLFPLTHCCGPGLRPTSQEDK
A0A2R9BS98_BMF-01       -----------------------CPLSRLQLFPLTHCCGPGLRPTSQEDK
A0A2R9BZA9_BBC3-01      -HLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2R9AKC9_PMAIP1-      SSSSSPLALPRGHEEQAQVAGSRVCYSTQEIWRQTELPAETSESDIQTLL
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2R9CA99_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2R9CA99_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2R9CA99_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2R9CA99_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2R9CA99_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A2R9AKC9_PMAIP1-      --------------------KLNFRQKLLNLISKLFCSGT----------
A0A2R8ZXD2_BIK-01       ----GSDALALRLACIGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTE
A0A2R8Z697_BAD-02       EERGHSNADAAKLQLDASLPVLVGSELGQGKLRPLPVTF-----------
A0A2R8Z697_BAD-03       ED--SENPSAGMLAEASAGMSAPAADSEAQHAENVKLEALGLW-------
A0A2R8Z697_BAD-01       DEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-------
A0A2R9BS98_BMF-02       ATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCVVADPPL------
A0A2R9BS98_BMF-01       ATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGE
A0A2R9BZA9_BBC3-01      YERRRQE---EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN-----
A0A2R9AKC9_PMAIP1-      LRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW--------------
A0A2R9CA99_BCL2L11      -------------------------------ASMRQAEPADMRPEIWIAQ
A0A2R9CA99_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM----DDSAGSSLRIAL---
A0A2R9CA99_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFT
A0A2R9CA99_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2R9CA99_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2R9CA99_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
A0A2R9CA99_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A2R9CA99_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
A0A2R9CA99_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2R9CA99_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
                                                                          

A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2R8ZXD2_BIK-01       DIRDVLRSFMDGFTTLKENIMRFWRSPNPRSWVSREQVLLALLLLLALLL
A0A2R8Z697_BAD-02       ----APHPETPPVPTALGSHLEYGRKYFPQAYAKRGSV-----------L
A0A2R8Z697_BAD-03       -RSGVA---TAPTPRGRRTTKGWGR--SPAPFGAARAR-----------R
A0A2R8Z697_BAD-01       -KKGLPRPKSAGTATQMRQSSSWTR--VFQSWWDRNLG-----------R
A0A2R9BS98_BMF-02       -PAQPCFEWRREQERGRP--------------------------------
A0A2R9BS98_BMF-01       QPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLH
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2R9CA99_BCL2L11      ELRRIGDEFNAYYARRLAKLLSST--------------------------
A0A2R9CA99_BCL2L11      -----------------HREVQWPLKWLAKSS------------------
A0A2R9CA99_BCL2L11      GLDLYGHHHSQDAEQLNHKDFS----------------------------
A0A2R9CA99_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH--
A0A2R9CA99_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH--
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      ELRRIGDEFNAYYARRMPLPPD----------------------------
A0A2R9CA99_BCL2L11      ELRRIGDEFNAYYARRLEK-------------------------------
                                                                          

A0A2R9AKC9_PMAIP1-      ----------------
A0A2R8ZXD2_BIK-01       PLLSGGLHLLLK----
A0A2R8Z697_BAD-02       SPLEGGLTQIPFRCV-
A0A2R8Z697_BAD-03       PPTSGQHSAMAASSGG
A0A2R8Z697_BAD-01       GSSAPSQ---------
A0A2R9BS98_BMF-02       ----------------
A0A2R9BS98_BMF-01       NLALNGEENRNGAGPR
A0A2R9BZA9_BBC3-01      ----------------
A0A2R9AKC9_PMAIP1-      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
A0A2R9CA99_BCL2L11      ----------------
                                        

© 1998-2019