Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9AKC9_PMAIP1-      -------------------------------------------------M
A0A2R8ZXD2_BIK-01       MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTESEEDLDPMEDFDSLEC
A0A2R8Z697_BAD-01       MFQI--------------------------------PEFEPSEQEDSSSA
A0A2R8Z697_BAD-02       MFQI--------------------------------PEFEPSEQEDSSSA
A0A2R8Z697_BAD-03       MFQI--------------------------------PEFEPSEQEDSSSA
A0A2R9BS98_BMF-02       --------------------------------------MEPSQCVEELED
A0A2R9BS98_BMF-01       --------------------------------------MEPSQCVEELED
A0A2R9BZA9_BBC3-01      -------------------------------------MKFGMGSAQACPC
A0A2R9AKC9_PMAIP1-      ---------------------------------------MPGKKARKNAQ
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2R9CA99_BCL2L11      ------------------------------------MAKQPSDVSSECDR
                                                                          

A0A2R9AKC9_PMAIP1-      PGKKARKNAQPSPARAPAELEVECATQ-----------------------
A0A2R8ZXD2_BIK-01       MEGSDALALRLACIGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDI
A0A2R8Z697_BAD-01       ERG-----LGPSPAGDGPSGSSKHHRQAP-----------GLLWDASHQQ
A0A2R8Z697_BAD-02       ERG-----LGPSPAGDGPSGSSKHHRQAP-----------GLLWDASHQQ
A0A2R8Z697_BAD-03       ERG-----LGPSPAGDGPSGSSKHHRQAP-----------GLLWDASHQQ
A0A2R9BS98_BMF-02       D--VFQPEDGEPVTQPGSLLSADLFAQSLLD-------------------
A0A2R9BS98_BMF-01       D--VFQPEDGEPVTQPGSLLSADLFAQSLLD-------------------
A0A2R9BZA9_BBC3-01      QVPRAASVTWVPCQICGPQPSLSLAEQ----------HLESPVPSAPGAL
A0A2R9AKC9_PMAIP1-      PSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLSSSSSSPLALPRGHE
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQ-----------------------
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQ-----------------------
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPL
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQ-----------------------
A0A2R9CA99_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQ-----------------------
                                                                          

A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2R8ZXD2_BIK-01       RDVLRSFMDGFTTLKENIMRFWRSPNP-----------------------
A0A2R8Z697_BAD-01       EQPTSSSHHGGAGAVEIRSRHSSYPAGT-------------EDDEGMGEE
A0A2R8Z697_BAD-02       EQPTSSSHHGEGTSSPEERGHSNADAAKLQLDASLPVLVGSELGQGKLRP
A0A2R8Z697_BAD-03       EQPTSSSHHGGRTSYSPSWESEDSENPSAGMLA--------EASAGMSAP
A0A2R9BS98_BMF-02       ---------CPLSRLQLFPLTHCCGPGLRPTSQED---------------
A0A2R9BS98_BMF-01       ---------CPLSRLQLFPLTHCCGPGLRPTSQED---------------
A0A2R9BZA9_BBC3-01      AGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA---------------
A0A2R9AKC9_PMAIP1-      EQAQVAGSRVCYSTQEIWRQTELPAETSESDIQTL---------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF---------------
A0A2R9CA99_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF---------------
A0A2R9CA99_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF---------------
A0A2R9CA99_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF---------------
A0A2R9CA99_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF---------------
A0A2R9CA99_BCL2L11      APPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF---------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
                                                                          

A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2R8ZXD2_BIK-01       ----------------------------------------RSWVSREQVL
A0A2R8Z697_BAD-01       PSPFRGR------------------SRSAPPNLWAAQRYGRELRRMSDEF
A0A2R8Z697_BAD-02       LPVTFAPHPE---------------TPPVPTALGSHLEYGRKY------F
A0A2R8Z697_BAD-03       AADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRS--------
A0A2R9BS98_BMF-02       -------------------------KATQTLSPASPSQGVMLPCGVTEEP
A0A2R9BS98_BMF-01       -------------------------KATQTLSPASPSQGVMLPCGVTEEP
A0A2R9BZA9_BBC3-01      -------------------------QYERRRQE---EQQRHRPSPWRVLY
A0A2R9AKC9_PMAIP1-      -------------------------LLRNLTASKTCMRGLLQKSFLRRCT
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      ---------------------------DRSPAPMSCDKSTQTPSPPCQAF
A0A2R9CA99_BCL2L11      -------------------------DTDRSPAPMSCDKSTQTPSPPCQAF
A0A2R9CA99_BCL2L11      -------------------------DTDRSPAPMSCDKSTQTPSPPCQAF
A0A2R9CA99_BCL2L11      -------------------------DTDRSPAPMSCDKSTQTPSPPCQAF
A0A2R9CA99_BCL2L11      -------------------------DTDRSPAPMSCDKSTQTPSPPCQAF
A0A2R9CA99_BCL2L11      -------------------------DTDRSPAPMSCDKSTQTPSPPCQAF
A0A2R9CA99_BCL2L11      -------------------------DTDRSPAPMSCDKSTQTPSPPCQAF
A0A2R9CA99_BCL2L11      ---------------------------DRSPAPMSCDKSTQTPSPPCQAF
A0A2R9CA99_BCL2L11      ---------------------------DRSPAPMSCDKSTQTPSPPCQAF
                                                                          

A0A2R9AKC9_PMAIP1-      LRRFGDKLNFRQKLLNLISKLFCSGT------------------------
A0A2R8ZXD2_BIK-01       LALLLLLALLLPLLSGGLHLLLK---------------------------
A0A2R8Z697_BAD-01       VDSF-KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--
A0A2R8Z697_BAD-02       PQAYAKRGSVLSPLEGGLTQIPFRCV------------------------
A0A2R8Z697_BAD-03       PAPFGAARARRPPTSGQHSAMAASSGG-----------------------
A0A2R9BS98_BMF-02       QRLFYAPAEPKSCVVADPPL-------PAQPCFEWRREQERGRP------
A0A2R9BS98_BMF-01       QRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIAD
A0A2R9BZA9_BBC3-01      NLIMGLLPLPRGHRAPEMEPN-----------------------------
A0A2R9AKC9_PMAIP1-      FHQFEERLHCNW--------------------------------------
A0A2R9CA99_BCL2L11      -------ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKLLSST
A0A2R9CA99_BCL2L11      NHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQA
A0A2R9CA99_BCL2L11      NHYLSAMVREIEEVVV----------------------------------
A0A2R9CA99_BCL2L11      NHYLSAMGIFE---------------------------------------
A0A2R9CA99_BCL2L11      NHYLSAMANWD---------------------------------------
A0A2R9CA99_BCL2L11      NHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQA
A0A2R9CA99_BCL2L11      NHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK-----
A0A2R9CA99_BCL2L11      NHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLPPD--
A0A2R9CA99_BCL2L11      NHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHSQDAEQLNHKDFS--
A0A2R9CA99_BCL2L11      NHYLSAM----DDSAGSSLRIAL--------------------HREVQWP
                                                                          

A0A2R9AKC9_PMAIP1-      ------------------------------------------
A0A2R8ZXD2_BIK-01       ------------------------------------------
A0A2R8Z697_BAD-01       ------------------------------------------
A0A2R8Z697_BAD-02       ------------------------------------------
A0A2R8Z697_BAD-03       ------------------------------------------
A0A2R9BS98_BMF-02       ------------------------------------------
A0A2R9BS98_BMF-01       QFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2R9BZA9_BBC3-01      ------------------------------------------
A0A2R9AKC9_PMAIP1-      ------------------------------------------
A0A2R9CA99_BCL2L11      ------------------------------------------
A0A2R9CA99_BCL2L11      AEDHPRMVILRLLRYIVRLVWRMH------------------
A0A2R9CA99_BCL2L11      ------------------------------------------
A0A2R9CA99_BCL2L11      ------------------------------------------
A0A2R9CA99_BCL2L11      ------------------------------------------
A0A2R9CA99_BCL2L11      AEDHPRMVILRLLRYIVRLVWRMH------------------
A0A2R9CA99_BCL2L11      ------------------------------------------
A0A2R9CA99_BCL2L11      ------------------------------------------
A0A2R9CA99_BCL2L11      ------------------------------------------
A0A2R9CA99_BCL2L11      LKWLAKSS----------------------------------
                                                                  

© 1998-2018