Dataset for protein Bad of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8Z697_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
A0A2R8Z697_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
A0A2R8Z697_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
                       **************************************************

A0A2R8Z697_BAD-01      QQEQPTSSSHHGGAGAVEIRSRHSSYPAGT-------------EDDEGMG
A0A2R8Z697_BAD-02      QQEQPTSSSHHGEGTSSPEERGHSNADAAKLQLDASLPVLVGSELGQGKL
A0A2R8Z697_BAD-03      QQEQPTSSSHHGGRTSYSPSWESEDSENPSAGMLA--------EASAGMS
                       ************   :       ..    .             * . *  

A0A2R8Z697_BAD-01      EEPSPFRGR------------------SRSAPPNLWAAQRYGRELRRMSD
A0A2R8Z697_BAD-02      RPLPVTFAPHPE---------------TPPVPTALGSHLEYGRKY-----
A0A2R8Z697_BAD-03      APAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRS------
                          .   .                   : ..*    :   :**.      

A0A2R8Z697_BAD-01      EFVDSF-KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
A0A2R8Z697_BAD-02      -FPQAYAKRGSVLSPLEGGLTQIPFRCV----------------------
A0A2R8Z697_BAD-03      --PAPFGAARARRPPTSGQHSAMAASSGG---------------------
                           .:       .   *  : :   .                       

© 1998-2018