Dataset for protein Bad of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8Z697_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
A0A2R8Z697_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
A0A2R8Z697_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASH
                       **************************************************

A0A2R8Z697_BAD-02      QQEQPTSSSHHGE--------------GTSSPEERGHSNADAAKLQLDAS
A0A2R8Z697_BAD-03      QQEQPTSSSHHGG---------RTSYSPSWESED--SENPSAGMLAEASA
A0A2R8Z697_BAD-01      QQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
                       ************                  . ::   .:...      ::

A0A2R8Z697_BAD-02      LPVLVGSELGQGKLRPLPVTF-------APHPETPPVPTALGSHLEYGRK
A0A2R8Z697_BAD-03      GMSAPAADSEAQHAENVKLEALGLWRSGVA---TAPTPRGRRTTKGWGR-
A0A2R8Z697_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTR-
                            .::        :            .   :. ..        : * 

A0A2R8Z697_BAD-02      YFPQAYAKRGSVLSPLEGGLTQIPFRCV-
A0A2R8Z697_BAD-03      -SPAPFGAARARRPPTSGQHSAMAASSGG
A0A2R8Z697_BAD-01      -VFQSWWDRNLGRGSSAPSQ---------
                           .:        .              

© 1998-2019