Dataset for protein classical BH3-containing proteins of organism Ovis aries

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W5P738_PMAIP1-01       -----------------------------------------MPGRRARRS
W5QCU2_BIK-01          --------------------------------------------MYQARP
W5P8G9_BAD-01          QGPRYRAWAQSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWL
W5PY58_BCL2L11-01      -----------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAP
W5QFV1_BMF-01          -----------------LTGEMEPPQCVEELEDDVFQPEDGEPGAQPRRL
                                                                         

W5P738_PMAIP1-01       AQPSP---------------------------------------------
W5QCU2_BIK-01          LSRNLFLYTFLQNHGPGFLDDQGSGLPGVTSILEFHPISPYSDSPHYLAM
W5P8G9_BAD-01          TAPGLLGEAGHQQGQP-----AGSSHHGGTGAVETRSRHSSYPAG--PED
W5PY58_BCL2L11-01      TSLQT-----ERQGNP-----EGEGDRCPQGSPQG-PLAPPASPG-----
W5QFV1_BMF-01          LSADL-----FAQSQL-----D-----CPLSRLQLFPLTHCCGPGLRPTS
                                                                         

W5P738_PMAIP1-01       -------------------------------------------------T
W5QCU2_BIK-01          QLASIADEMELRLLLPQFVEPFWMPMYSLCFPYSHVGLRDVLRSFMVAFT
W5P8G9_BAD-01          DEGTEEEDLGPFRGRSRSAPPNLWAAQR-----YGRELRRMSDEFHVSFK
W5PY58_BCL2L11-01      -------PFAT-------RSPLFIFVRR-----SSLLSRSSSGYFSFDTD
W5QFV1_BMF-01          QEDKATQTLSP-------ASPSQGVMLP-----CGVTEEPQRLFYGNAGY
                                                                         

W5P738_PMAIP1-01       RVPADPEVECAIQLRRIGDKLNFRQ-------------------KLVNLI
W5QCU2_BIK-01          NLRENRRLWSFLTLRDRVSPSLWPE------------------LALSLLV
W5P8G9_BAD-01          GLPRPKSAGTATQMRQSPSWTRFLQ---------------------SWLS
W5PY58_BCL2L11-01      RSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIA
W5QFV1_BMF-01          RLPLPASFPAGLPLGEQPPEGQWQH------------------RAEIQIA
                                             :                         : 

W5P738_PMAIP1-01       AKLLRSGT------------------------------------------
W5QCU2_BIK-01          VAMLSWGCRF----------------------------------------
W5P8G9_BAD-01          RNLGRGGSAPSQ--------------------------------------
W5PY58_BCL2L11-01      QELRRIGDEFNAYYPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ--
W5QFV1_BMF-01          RKLQCIADQFHR-------LHMQQHQQNRNRMWWQILLFLHNVALNGDEN
                         :   .                                           

W5P738_PMAIP1-01       -------
W5QCU2_BIK-01          -------
W5P8G9_BAD-01          -------
W5PY58_BCL2L11-01      -------
W5QFV1_BMF-01          RNGAGPR
                              

© 1998-2018