Dataset for protein classical BH3-containing proteins of organism Otolemur garnettii

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H0Y001_HRK-01          --------------MCPCPLHRGRGPPAVCACSAGR--------------
H0XAE7_BIK-01          -------------------------MSAGRPVSMDHFMETFPFE------
H0WVR2_BAD-01          MFQIPEFEPSEQEDSSSSDRGLGPSPSGDQPLGPGKN-------------
H0WYH6_BMF-01          ----------MEPSQCVEELEDDVFQPEDGELGTGNVLSADL---FAQSQ
H0XQ00_BBC3-01         ------MARARQE-GSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPG
H0XW23_BCL2L11-01      ------MAKQPSDVGSECDREGGQLQPAERPPQL----------------
                                                                         

H0Y001_HRK-01          --------------------------------------------------
H0XAE7_BIK-01          ---QLLEPLTMEVLGMTEPNPMECLEDSDQ--------------------
H0WVR2_BAD-01          ---RCTTPSLL--GDASHLQGQPASNTHHGAGPGAVETRSRHSSYPAGT-
H0WYH6_BMF-01          LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGV-
H0XQ00_BBC3-01         LPAAPAAPALLPAAYLCAPTAPPAVTATLG----GPRWPGGPRSRPRGPR
H0XW23_BCL2L11-01      ---RPGAPTSLHTEPQGNPEGNPEVEGDRC----PQGSPQGPLAPPASP-
                                                                         

H0Y001_HRK-01          --------------------------------------------------
H0XAE7_BIK-01          --------------------------------VALRLACIGDEMDLHLRS
H0WVR2_BAD-01          ----------------------------------------EEDEGIEEPS
H0WYH6_BMF-01          --------------------------------TEEPQRLFYGNVGYRLPL
H0XQ00_BBC3-01         LDGP-------------------------------QPSLLPAEQHLESPV
H0XW23_BCL2L11-01      --GPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
                                                                         

H0Y001_HRK-01          -------------LGLRSSAAQLT-----------AARLKALGDELHQRT
H0XAE7_BIK-01          PRLAQLSRMTMHSLGLSYNQTDGQGV------------LRSVISGFTNLR
H0WVR2_BAD-01          P------------FRGRSRSAPPNLWAAQRY----GRELRRMSDEFEDSF
H0WYH6_BMF-01          PASFP--------AGLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLH
H0XQ00_BBC3-01         PSTPG------ALAGGPTQAAPEVRGEEEQWAREIGAQLRRMADDLNAQY
H0XW23_BCL2L11-01      PPCQAFNHYLSAMASMRQSQAEPADLRPEMW---IAQELRRIGDEFNAYY
                                                             *. : . :    

H0Y001_HRK-01          -----MWRRRARSRRAPAPGALTTYWPWLCAAAQVAALAAWLLGRRNL
H0XAE7_BIK-01          ENIAGFWRSLSRGPWVCPAPAWEQVLLLLLLLVLLLAGGLHLLLK---
H0WVR2_BAD-01          KKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNVGRGGSAPCQ-----
H0WYH6_BMF-01          --------V--QQHQQNQNRVWWQVLFFLHN--LALNGEENRNGAGPR
H0XQ00_BBC3-01         ERR-----R--QEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
H0XW23_BCL2L11-01      PTRVFLHNY--QAAEDHPQMVILRLLRYIVRLVWRLH-----------
                                                                       

© 1998-2018