Dataset for protein classical BH3-containing proteins of organism Oryzias melastigma

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3BQF7_BAD-01      MAAKFSISDNDSESSEEVEGGRLDLAA----SGGEGGGGGGGHLHDRHAL
A0A3B3CGR9_BMF-01      -------MDDEEDDVFEPDPNNWRTAVRKIKCEDRGTQTPGPALVPNNGM
                               *::.:.  * : ..   *.    . . *    *  *  .:.:

A0A3B3BQF7_BAD-01      TLPEL--------------RLTSNGRTRLNSESTVSTYSRD------EDL
A0A3B3CGR9_BMF-01      LLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEARRHDREAERGGMERL
                        *  *              **   .*  * .:  .  :.*:      * *

A0A3B3BQF7_BAD-01      PREDEAGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKG
A0A3B3CGR9_BMF-01      PRQQPAARSTEACI------------------AQKLQLIGDQFH------
                       **:: *. .*:.                    .*:*. :.*:*       

A0A3B3BQF7_BAD-01      EMRKVRSAGATKQMHHSTSWWNY---LFSHPEAEGEYSHHESHRTE
A0A3B3CGR9_BMF-01      --RERLQLYHQNQRNQGPLWWRLTTALVSLLLDRGFIAGGGGAGQR
                         *:  .    :* ::.. **.    *.*     *  :   .    

© 1998-2019