Dataset for protein classical BH3-containing proteins of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3HDU2_BAD-01      MAAKFTISDDSESSEEVEGGKLDLGA--------AAGGEGEHLHDRHSLT
A0A3B3I0V9_BMF-04      ------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
A0A3B3I0V9_BMF-02      ------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
A0A3B3I0V9_BMF-01      ------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
A0A3B3I0V9_BMF-03      ------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
A0A3P9JM16_BMF-03      ------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
A0A3P9JM16_BMF-02      ------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
A0A3P9JM16_BMF-01      ------MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGML
                             :.*:.:.  * : .*    *        .:   *  *  .:.: 

A0A3B3HDU2_BAD-01      LPEL--------------RLTSNGRTRLNSESTASTYSRDEDLAREDEAG
A0A3B3I0V9_BMF-04      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDRE----------
A0A3B3I0V9_BMF-02      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDRE----------
A0A3B3I0V9_BMF-01      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDRE----------
A0A3B3I0V9_BMF-03      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDRE----------
A0A3P9JM16_BMF-03      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDRE----------
A0A3P9JM16_BMF-02      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDRE----------
A0A3P9JM16_BMF-01      LCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRRHDRE----------
                       *  *              **   .*  * .:  .  :.*:          

A0A3B3HDU2_BAD-01      TPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRS
A0A3B3I0V9_BMF-04      --AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRN
A0A3B3I0V9_BMF-02      --AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRN
A0A3B3I0V9_BMF-01      --AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRN
A0A3B3I0V9_BMF-03      --AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRN
A0A3P9JM16_BMF-03      --AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRN
A0A3P9JM16_BMF-02      --AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRN
A0A3P9JM16_BMF-01      --AERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRN
                         ::  .:   ... * *  :    .*:*. :.*:*     :   *: *.

A0A3B3HDU2_BAD-01      TGAAKQMLHSTSWW-------NYLFSHP--EAEGEYSHHESHRTE
A0A3B3I0V9_BMF-04      QGPV--------WWRLATALVSLLFDRGFIAGAGGAGQRQSVVSD
A0A3B3I0V9_BMF-02      QGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3B3I0V9_BMF-01      QGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3B3I0V9_BMF-03      QGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3P9JM16_BMF-03      QGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3P9JM16_BMF-02      QGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR------
A0A3P9JM16_BMF-01      QGPV--------WWRLATALVSLLFDRGFIAGAGGAGQR------
                        *..        **       . **..    . *  .:.      

© 1998-2019