Dataset for protein Bmf of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3I0V9_BMF-04      MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
A0A3B3I0V9_BMF-02      MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
A0A3B3I0V9_BMF-01      MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
A0A3B3I0V9_BMF-03      MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
A0A3P9JM16_BMF-03      MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
A0A3P9JM16_BMF-02      MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
A0A3P9JM16_BMF-01      MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAE
                       **************************************************

A0A3B3I0V9_BMF-04      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
A0A3B3I0V9_BMF-02      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
A0A3B3I0V9_BMF-01      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
A0A3B3I0V9_BMF-03      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
A0A3P9JM16_BMF-03      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
A0A3P9JM16_BMF-02      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
A0A3P9JM16_BMF-01      EPRPLFYGNAGFRLHFPARFELAGDLEVRRHDREAERRGMERLPRQQPVA
                       **************************************************

A0A3B3I0V9_BMF-04      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
A0A3B3I0V9_BMF-02      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
A0A3B3I0V9_BMF-01      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
A0A3B3I0V9_BMF-03      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
A0A3P9JM16_BMF-03      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
A0A3P9JM16_BMF-02      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
A0A3P9JM16_BMF-01      RSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFD
                       **************************************************

A0A3B3I0V9_BMF-04      RGFIAGAGGAGQRQSVVSD
A0A3B3I0V9_BMF-02      RGFIAGAGGAGQR------
A0A3B3I0V9_BMF-01      RGFIAGAGGAGQR------
A0A3B3I0V9_BMF-03      RGFIAGAGGAGQR------
A0A3P9JM16_BMF-03      RGFIAGAGGAGQR------
A0A3P9JM16_BMF-02      RGFIAGAGGAGQR------
A0A3P9JM16_BMF-01      RGFIAGAGGAGQR------
                       *************      

© 1998-2019