Dataset for protein classical BH3-containing proteins of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1SR62_BMF-01          --MEPPQCVEELEDD--VFQPEDGEPGTQP--QSLLSADPFAQSQLDCPL
G1SSY0_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQGNPEGDRCA
G1T7W1_HRK-01          ------------------MCPCPLHRGRGP----------PAVCACSAGR
G1SS60_BAD-01          ------------------PRPKPLSAGAGAMETRSRHSSYPADADDSEGA
G1TZR9_BIK-01          --------------------MSEVRPGSRDLFQEALLDEQVPEPLLTAEV
                                                                         

G1SR62_BMF-01          GRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
G1SSY0_BCL2L11-01      HGSPQGPLAPSASPG------------PFATRSPLFIFVRRSSLLSRSSS
G1T7W1_HRK-01          LGLRS---------------------------------------------
G1SS60_BAD-01          EEEPS---------------------------------------------
G1TZR9_BIK-01          PGLTR---------------------------------------------
                                                                         

G1SR62_BMF-01          LFYGNAGYRLPLPAS-----------------FPANFALGEQPPEGQWQH
G1SSY0_BCL2L11-01      GYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADT
G1T7W1_HRK-01          -------------------------------------A------------
G1SS60_BAD-01          -------------------------------------PFRGRSRSAPPNL
G1TZR9_BIK-01          -------------------------------------PVEEGDLDLMECL
                                                            .            

G1SR62_BMF-01          RAEVQIARKLQCIADQFHRLHLQQ--------HQQNRNRVWWQ-------
G1SSY0_BCL2L11-01      RPETWIAQELRRIGDEFNAYYPRRVFLNNYPAAEEQPQMVILR-------
G1T7W1_HRK-01          -AAQLTAARLKALGDELHQRT-----------------------------
G1SS60_BAD-01          WAAQRYGRELRRMSDEFEGSVKKGLPRPKSAGTAMQMRESS---------
G1TZR9_BIK-01          EGSNQVALRLAYIGDEMDLHV-RGLHTGPAAGVAMHSLAFTYSQTGFTGV
                             .  *  :.*::                                 

G1SR62_BMF-01          ------ILLFLHNLALNGDENRDGAGPR----------------------
G1SSY0_BCL2L11-01      ------LLRYIVRLVWRMH-------------------------------
G1T7W1_HRK-01          -------------MWRRRARSRRAPAPGA-LPTYWPWLCAAAQVAALAAW
G1SS60_BAD-01          ------SWTRVIQSWWDRNLGKGGSAPSQ---------------------
G1TZR9_BIK-01          LGSVGLHLASLVELW--SPWGRGAAAPAAVRPLPGQGWPPSWRVVLLGAG
                                                                         

G1SR62_BMF-01          -------
G1SSY0_BCL2L11-01      -------
G1T7W1_HRK-01          LLGRRNL
G1SS60_BAD-01          -------
G1TZR9_BIK-01          SWGLRMP
                              

© 1998-2018