Dataset for protein classical BH3-containing proteins of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3K2D6_BMF-01      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNA
I3K7B6_BAD-01      ---------------MAANFTISDSESETSEEVG----EEENQQPAGQDQESKPQTLALP
                                    :.*   ..*   ::  *     ::.  *.*  :*..*   . .

I3K2D6_BMF-01      GFRLHF-PARFELVG----DHRARRQE---IAEQQNSMERLPRQRPAARSVEACIGQKLQ
I3K7B6_BAD-01      VIKTTVQPNQWNALGMRDEDLMARGEDEVCTPTEGDPFRRRSKSAPPALWAAKKYGQKLR
                    :.  . * .:: :*    *  ** ::    . : :.: * ... *.*  .    ****.

I3K2D6_BMF-01      LIGDQFHW------ERLQLYHRNQRNQGPMWWRLAAALLSLLFDRGFIAGGGGGGRR
I3K7B6_BAD-01      RMSDEFDSLLDKGEMKLKKLHHSK-----TWW-------SYLFSHQETEGENNHLE-
                    :.*:*         .*:  *..:      **       * **..    * ..    

© 1998-2018