Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HX97_PMAIP1-      --------------------KPGRARRNAQPSPAPA--------------
A0A2I3HWI8_BBC3-03      MKFGMGSARACPCQVPRASSVTWVPCQICAGGPTQAAPGVRGE-------
A0A2I3HD83_BMF-01       ---------MEPSQCVEELEDD--VFQPEDGEPGTQ----PGSLLSADLF
G1S1X2_BIK-01           --------MSEVRPISRDILMESLLYEQLLEPPTMEVLGVTDP-------
G1QHD8_HRK-01           MCPCPLHRGRGPPAV---CACSAGRLGLRSSAAQLT----AAR-------
A0A2I3H4B2_BAD-01       -------MGEEPSPFRGRSRSAPPNLWAAQRYGREL----RRM-------
A0A2I3HW02_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----PGA-------
A0A2I3HW02_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----PGA-------
A0A2I3HW02_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----PGA-------
A0A2I3HW02_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----PGA-------
A0A2I3HW02_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----PGA-------
A0A2I3HW02_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----PGA-------
A0A2I3HW02_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----PGA-------
A0A2I3HW02_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR----PGA-------
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------PAELEVECAT--------------
A0A2I3HWI8_BBC3-03      --------------------------EEQWAREIGAQLRRMADDLNAQYE
A0A2I3HD83_BMF-01       AQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLP
G1S1X2_BIK-01           --------------------------EEDLDPMEDFDPLQCMEGSDALAP
G1QHD8_HRK-01           --------------------------LKALGDELH---------------
A0A2I3H4B2_BAD-01       --------------------------SDEFVDSFKGLPRPKSAGTATQ--
A0A2I3HW02_BCL2L11      --------------------------PTSLQTEPQGNPEGNHGGEGDSCP
A0A2I3HW02_BCL2L11      --------------------------PTSLQTEPQGNPEGNHGGEGDSCP
A0A2I3HW02_BCL2L11      --------------------------PTSLQTEPQGNPEGNHGGEGDSCP
A0A2I3HW02_BCL2L11      --------------------------PTSLQTEPQGNPEGNHGGEGDSCP
A0A2I3HW02_BCL2L11      --------------------------PTSLQTEPQGNPEGNHGGEGDSCP
A0A2I3HW02_BCL2L11      --------------------------PTSLQTEPQ---------------
A0A2I3HW02_BCL2L11      --------------------------PTSLQTEPQ---------------
A0A2I3HW02_BCL2L11      --------------------------PTSLQTEPQ---------------
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-03      RRRQEEQQ------------------------------------------
A0A2I3HD83_BMF-01       CGVTEEPQRLFYAPAEPKSRVV----------------------------
G1S1X2_BIK-01           RLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMD
G1QHD8_HRK-01           ------------------------------------------------QR
A0A2I3H4B2_BAD-01       --------------------------------------------------
A0A2I3HW02_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2I3HW02_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2I3HW02_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2I3HW02_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2I3HW02_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2I3HW02_BCL2L11      ---------------------------------------------ASMRQ
A0A2I3HW02_BCL2L11      ---------------------------------------------DRSPA
A0A2I3HW02_BCL2L11      ---------------------------------------------DRSPA
                                                                          

A0A2I3HX97_PMAIP1-      ------------QLRRFGDKLNFRQKLLNLISKLFCSGT-----------
A0A2I3HWI8_BBC3-03      ------------RHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN------
A0A2I3HD83_BMF-01       ------------ADPPLPAQPCFEWRREQEWGRP----------------
G1S1X2_BIK-01           GFTTFKENIIRLWRSPNPGSRVSREQMLLVLLVLLLLLLPLLSGGLYLLN
G1QHD8_HRK-01           TMWRRRA-----RSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL-
A0A2I3H4B2_BAD-01       ------------MRQSSSWTRVFQSWWDRNLGRGSSAPSQ----------
A0A2I3HW02_BCL2L11      PMSCDKS-----TQTPSPPCQAFNHYLSAMVREIEEVVV-----------
A0A2I3HW02_BCL2L11      PMSCDKS-----TQTPSPPCQAFNHYLSAMGIFE----------------
A0A2I3HW02_BCL2L11      PMSCDKS-----TQTPSPPCQAFNHYLSAMANWD----------------
A0A2I3HW02_BCL2L11      PMSCDKS-----TQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQE
A0A2I3HW02_BCL2L11      PMSCDKS-----TQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQE
A0A2I3HW02_BCL2L11      AEPADMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST-----------
A0A2I3HW02_BCL2L11      PMSCDKS-----TQTPSPPCQAFNHYLSAMDEAAGSSLEVQWPFEWLAKS
A0A2I3HW02_BCL2L11      PMSCDKS-----TQTPSPPCQAFNHYLSAMVVILEDVGDISLWFGFIFTG
                                                                          

A0A2I3HX97_PMAIP1-      -----------------------------------------------
A0A2I3HWI8_BBC3-03      -----------------------------------------------
A0A2I3HD83_BMF-01       -----------------------------------------------
G1S1X2_BIK-01           -----------------------------------------------
G1QHD8_HRK-01           -----------------------------------------------
A0A2I3H4B2_BAD-01       -----------------------------------------------
A0A2I3HW02_BCL2L11      -----------------------------------------------
A0A2I3HW02_BCL2L11      -----------------------------------------------
A0A2I3HW02_BCL2L11      -----------------------------------------------
A0A2I3HW02_BCL2L11      LRRIGDEFNAYYARRLEK-----------------------------
A0A2I3HW02_BCL2L11      LRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2I3HW02_BCL2L11      -----------------------------------------------
A0A2I3HW02_BCL2L11      S----------------------------------------------
A0A2I3HW02_BCL2L11      LDLYGHHHSQDTEQFNHKDFS--------------------------
                                                                       

© 1998-2019