Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HX97_PMAIP1-      ----------KPGRARR---------------NAQPSPAPAPAELEVECA
A0A2I3HWI8_BBC3-03      MKFGMGSARACPCQVPRASSVTWVPCQICAGGPTQAAPGVRGEEEQWARE
A0A2I3HD83_BMF-01       ---------MEPSQCVE------------ELEDDVFQPEDGEPGTQPGSL
G1S1X2_BIK-01           --------MSEVRPISR----------DILMESLLYEQLLEPPTMEVLGV
G1QHD8_HRK-01           -------MCPCPLHRGRGPPA------VCACSAGRLGLRSSAAQLTAARL
A0A2I3H4B2_BAD-01       -------MGEEPSPFRGRSRSAPPNLWAAQRYGRELR------RMSDEFV
A0A2I3HW02_BCL2L11      -------MAKQPSDVSS----------ECDREGRQLQPAERPPQLRPGAP
A0A2I3HW02_BCL2L11      -------MAKQPSDVSS----------ECDREGRQLQPAERPPQLRPGAP
A0A2I3HW02_BCL2L11      -------MAKQPSDVSS----------ECDREGRQLQPAERPPQLRPGAP
A0A2I3HW02_BCL2L11      -------MAKQPSDVSS----------ECDREGRQLQPAERPPQLRPGAP
A0A2I3HW02_BCL2L11      -------MAKQPSDVSS----------ECDREGRQLQPAERPPQLRPGAP
A0A2I3HW02_BCL2L11      -------MAKQPSDVSS----------ECDREGRQLQPAERPPQLRPGAP
A0A2I3HW02_BCL2L11      -------MAKQPSDVSS----------ECDREGRQLQPAERPPQLRPGAP
A0A2I3HW02_BCL2L11      -------MAKQPSDVSS----------ECDREGRQLQPAERPPQLRPGAP
                                                                          

A0A2I3HX97_PMAIP1-      TQLRRFGD------------------------------------------
A0A2I3HWI8_BBC3-03      IGAQLRRM------------------------------------------
A0A2I3HD83_BMF-01       LSADLFAQ---------SLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT
G1S1X2_BIK-01           T----DPEEDLDPMEDFDPLQCMEGSDALAPRLACIGDEMDVSLRAPRLA
G1QHD8_HRK-01           KALGDELH------------------------------------------
A0A2I3H4B2_BAD-01       DSFKGLPR------------------------------------------
A0A2I3HW02_BCL2L11      TSLQTEPQ------------------------------------------
A0A2I3HW02_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFM
A0A2I3HW02_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFM
A0A2I3HW02_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFM
A0A2I3HW02_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFM
A0A2I3HW02_BCL2L11      TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFM
A0A2I3HW02_BCL2L11      TSLQTEPQ------------------------------------------
A0A2I3HW02_BCL2L11      TSLQTEPQ------------------------------------------
                                                                          

A0A2I3HX97_PMAIP1-      -----------------------------------------KLNFRQKLL
A0A2I3HWI8_BBC3-03      --------------------------ADDLNAQYERRRQEEQQRHRPSPW
A0A2I3HD83_BMF-01       QTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKS-------RVVADPPLP
G1S1X2_BIK-01           QLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTFKENIIRLWRSPNPG
G1QHD8_HRK-01           ---------------------QRTMWRR-------------RARSRRAPA
A0A2I3H4B2_BAD-01       ---------------------PKSAGTA-------------TQMRQSSSW
A0A2I3HW02_BCL2L11      ------------------DRSPAPMSCD-------------KSTQTPSPP
A0A2I3HW02_BCL2L11      RRSSLLSRSSSGYFSFDTDRSPAPMSCD-------------KSTQTPSPP
A0A2I3HW02_BCL2L11      RRSSLLSRSSSGYFSFDTDRSPAPMSCD-------------KSTQTPSPP
A0A2I3HW02_BCL2L11      RRSSLLSRSSSGYFSFDTDRSPAPMSCD-------------KSTQTPSPP
A0A2I3HW02_BCL2L11      RRSSLLSRSSSGYFSFDTDRSPAPMSCD-------------KSTQTPSPP
A0A2I3HW02_BCL2L11      RRSSLLSRSSSGYFSFDTDRSPAPMSCD-------------KSTQTPSPP
A0A2I3HW02_BCL2L11      ------------------A-----------------------SMRQAEPA
A0A2I3HW02_BCL2L11      ------------------DRSPAPMSCD-------------KSTQTPSPP
                                                                          

A0A2I3HX97_PMAIP1-      NLISKLFCSGT---------------------------------------
A0A2I3HWI8_BBC3-03      RVLYNLIMGLLPLPRGHRAPEMEPN-------------------------
A0A2I3HD83_BMF-01       AQPCFEWRREQEWGRP----------------------------------
G1S1X2_BIK-01           SRVSREQMLLVLLVLLLLLLPLLSGGLYLLN-------------------
G1QHD8_HRK-01           PGALPTYWPWLCAAAQVAALAAWLLGRRNL--------------------
A0A2I3H4B2_BAD-01       TRVFQSWWDRNLGRGSSAPSQ-----------------------------
A0A2I3HW02_BCL2L11      CQAFNHYLSAMVVILEDVGDISLWFGFIFTGLDLYGHHHSQDTEQFNHKD
A0A2I3HW02_BCL2L11      CQAFNHYLSAMVREIEEVVV------------------------------
A0A2I3HW02_BCL2L11      CQAFNHYLSAMGIFE-----------------------------------
A0A2I3HW02_BCL2L11      CQAFNHYLSAMANWD-----------------------------------
A0A2I3HW02_BCL2L11      CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK-
A0A2I3HW02_BCL2L11      CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLN
A0A2I3HW02_BCL2L11      DMRPEIWIAQE--------------------LRRIGDEFNAYYARRLAKL
A0A2I3HW02_BCL2L11      CQAFNHYLSAM--------------------DEAAGSSLEVQWP---FEW
                                                                          

A0A2I3HX97_PMAIP1-      ----------------------------
A0A2I3HWI8_BBC3-03      ----------------------------
A0A2I3HD83_BMF-01       ----------------------------
G1S1X2_BIK-01           ----------------------------
G1QHD8_HRK-01           ----------------------------
A0A2I3H4B2_BAD-01       ----------------------------
A0A2I3HW02_BCL2L11      FS--------------------------
A0A2I3HW02_BCL2L11      ----------------------------
A0A2I3HW02_BCL2L11      ----------------------------
A0A2I3HW02_BCL2L11      ----------------------------
A0A2I3HW02_BCL2L11      ----------------------------
A0A2I3HW02_BCL2L11      NYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2I3HW02_BCL2L11      LASST-----------------------
A0A2I3HW02_BCL2L11      LAKSS-----------------------
                                                    

© 1998-2018