Dataset for protein Bim of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HW02_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I3HW02_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I3HW02_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I3HW02_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I3HW02_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I3HW02_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I3HW02_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I3HW02_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                        *****************************************         

A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3HW02_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3HW02_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3HW02_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3HW02_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3HW02_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDVGDISLWFGFIFT
A0A2I3HW02_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
A0A2I3HW02_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A2I3HW02_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
A0A2I3HW02_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2I3HW02_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2I3HW02_BCL2L11      -A----------SMRQAEPADMRPEIWIAQE-------------------
A0A2I3HW02_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-------------------
                                    * . ..*.    : :::                     

A0A2I3HW02_BCL2L11      GLDLYGHHHSQDTEQFNHKDFS--------------------------
A0A2I3HW02_BCL2L11      ------------------------------------------------
A0A2I3HW02_BCL2L11      ------------------------------------------------
A0A2I3HW02_BCL2L11      ------------------------------------------------
A0A2I3HW02_BCL2L11      ELRRIGDEFNAYYARRLEK-----------------------------
A0A2I3HW02_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2I3HW02_BCL2L11      -LRRIGDEFNAYYARRLAKLLASST-----------------------
A0A2I3HW02_BCL2L11      -DEAAGSSLEVQWP---FEWLAKSS-----------------------
                                                                        

© 1998-2018