Dataset for protein classical BH3-containing proteins of organism Neovison vison

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U6CSY8_BMF-01          --MEPPQCVEELEDD--VFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSR
U6CTE3_BCL2L11-04      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQ---------
U6CTE3_BCL2L11-03      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQ---------
U6CTE3_BCL2L11-01      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQGNPEGEGDR
U6CTE3_BCL2L11-02      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQGNPEGEGDR
                          :*.:  .* : :   :** :  *  .**:  * :   *         

U6CSY8_BMF-01          LHLFPLTHCCGPGLRPTSQEDKA------------------------TQT
U6CTE3_BCL2L11-04      --------------------------------------------------
U6CTE3_BCL2L11-03      -----------------------------------------------DRS
U6CTE3_BCL2L11-01      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
U6CTE3_BCL2L11-02      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                         

U6CSY8_BMF-01          LSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGDQPPE
U6CTE3_BCL2L11-04      ---------------------------ASRR--QSQAVPADM--------
U6CTE3_BCL2L11-03      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRR--QSQAVPADM--------
U6CTE3_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRR--QSQAVPADM--------
U6CTE3_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRR--QSQAVPADM--------
                                                  *. *   . :.**.:        

U6CSY8_BMF-01          GQWQHRAEVQIARKLQCIADQFHRLHMQQHQQ--------NQNRVWWQIL
U6CTE3_BCL2L11-04      -----RPEMWIAQELRRIGDEFNAYYPRRLARIPASCLC-----------
U6CTE3_BCL2L11-03      -----RPEMWIAQELRRIGDEFNAYYPRRLEQ------------------
U6CTE3_BCL2L11-01      -----RPEMWIAQELRRIGDEFNAYYPRRVFLNNYPAAEAHPQMIILRLL
U6CTE3_BCL2L11-02      -----RPEMWIAQELRRIGDEFNAYYPRRLEQ------------------
                            *.*:.**.:*. *.*:*:  : ..                     

U6CSY8_BMF-01          LFLHNLALNADGNRNGAGPR
U6CTE3_BCL2L11-04      --------------------
U6CTE3_BCL2L11-03      --------------------
U6CTE3_BCL2L11-01      RYIIRLVWRLQ---------
U6CTE3_BCL2L11-02      --------------------
                                           

© 1998-2019