Dataset for protein classical BH3-containing proteins of organism Neolamprologus brichardi

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q4G1I4_BMF-01      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
A0A3Q4GGN3_BAD-01      ---------------MAANFKISDSDSETSEEVGEG----ENQQSARQVQ
                                        :.*.  ..:   ::  * .    :.  ..  .:

A0A3Q4G1I4_BMF-01      EPRPLFYGNAGFRLHFPARFELVGDHRASRQGSTE--------------Q
A0A3Q4GGN3_BAD-01      ESKPQTLSLPVIKTTAAGRLRVNSESHTSSIARDEELMARGEDEVCTPTE
                       *..*   . . :.   ..*: : .: .:*  .  *              :

A0A3Q4G1I4_BMF-01      QNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYQRNQR-----
A0A3Q4GGN3_BAD-01      GDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFD----SLLDKGEMKLKKL
                        :.: * ... *.*  .    *.:*. :.*:*     .* :..:      

A0A3Q4G1I4_BMF-01      NQGPMWWRLAAAILSLLFDRGFIAGGGGGGRR------
A0A3Q4GGN3_BAD-01      HHSKTWW-------SYLFSHQETEGENNHLENHNQRTE
                       ::.  **       * **..    * ..   .      

© 1998-2019