Dataset for protein classical BH3-containing proteins of organism Myotis lucifugus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1P8C5_BAD-01          ---PTAQSMFQIPEFEHSEQEDSSP-------------------------
G1PAU1_BMF-01          MEPPQCVEELEDDVFQPEDELGTQPGSLPSADLFAQSQLDCPLSRLQLFP
G1P8F9_PMAIP1-01       --------------------------------------------------
G1PDJ5_BCL2L11-01      --------------------------------------------------
                                                                         

G1P8C5_BAD-01          ----ADRGLGPCPTGDQPPGLNKHWSTVPGLLGEAGHQQGQPASSSHHDG
G1PAU1_BMF-01          LTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAG
G1P8F9_PMAIP1-01       --------------------------------------------------
G1PDJ5_BCL2L11-01      --------------------------------------------------
                                                                         

G1P8C5_BAD-01          AGSVEPRSRHSSYPTGTEEDDDTEEGEPSPFRGRSRSAPPNLWAAQRYGR
G1PAU1_BMF-01          YRLPLP----ASFPAGSPLGEQPPEGQWQHHR-----------AEIQIAR
G1P8F9_PMAIP1-01       ------------MPGKKARKNAQPSPTRAPAE-----------AEIECAL
G1PDJ5_BCL2L11-01      -------------------SMQQSQALPVDMR-----------PEMWIAQ
                                               .                  .    . 

G1P8C5_BAD-01          ELRRMSDEFQGSFKKGLP-----RPKSAGTATQMWQKSSWTRFFQSW-WD
G1PAU1_BMF-01          KLQSIADQFH-----RLQ-----MQQHQQNRNRMWWQ--FLLFLHNLALN
G1P8F9_PMAIP1-01       QLRRIGDKLS-----------------------FLQK--LLNLMYKLFGS
G1PDJ5_BCL2L11-01      ELRRIGDEFNNSYRNPRRDFLNVYREAEGHPQMVVLR--LLRYILRLVWR
                       :*. :.*::                        .  .      :      

G1P8C5_BAD-01          RNSGRGGSAPSQ
G1PAU1_BMF-01          GDENRNGAGPR-
G1P8F9_PMAIP1-01       GT----------
G1PDJ5_BCL2L11-01      RM----------
                                   

© 1998-2018