Dataset for protein classical BH3-containing proteins of organism Mustela putorius furo

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M3Y0R3_BBC3-01         QAPGSAMARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGLWESDC
M3YDI3_BCL2L11-01      MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAPGAL-----KA
M3YAD5_BMF-01          MEPPQCVEELEDDVFQPEDGEPGTQPGS-------LLSADLFAQSQLDCP
M3YNE7_BAD-01          -------------MFQIPEFEPSEQEDS--------------------SP
                                                 .                       

M3Y0R3_BBC3-01         SPRVAAHGLFRAGAAAV-------------------SQPPPPPVWVSLTS
M3YDI3_BCL2L11-01      SPRLCLPRFFRAEGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAK
M3YAD5_BMF-01          LSRLHLFPLTHCCGPGL--------------------------RPTSQED
M3YNE7_BAD-01          ADR------------GL--------------------------GPSPTGD
                         *            .                                 .

M3Y0R3_BBC3-01         QRTIVGGSVGRARGLLFPGPQP------------------SLSPAEPHLE
M3YDI3_BCL2L11-01      QPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQDRSPAPMSCDKS
M3YAD5_BMF-01          KATQTLSPASPSQGVMLPCGVT----EEPQRLFYGNAGYRLPLPASFPAG
M3YNE7_BAD-01          QPPGLGKHLQTAPGLLGEAGHQ----QGQPASSSHHGGAGAVETRSRHSS
                       : .          * :                           . .    

M3Y0R3_BBC3-01         SPVPSAP--------GALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADD
M3YDI3_BCL2L11-01      TQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMW---IAQELRRIGDE
M3YAD5_BMF-01          LPLGDQPPEGQWQHR----------------AEVQ----IARKLQCIADQ
M3YNE7_BAD-01          YPAGTEEDEGMEEEELSPFRGRSRSAPPNLCAALR----YGRELRRMSDE
                                                               . :*. :.*:

M3Y0R3_BBC3-01         LNALYERR------RQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEME
M3YDI3_BCL2L11-01      FNAYYPRRVF-LNNYPAAEAHPQMIILRLLRYIIRLVWRLQ---------
M3YAD5_BMF-01          FH---------RLHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPR
M3YNE7_BAD-01          FQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNL----GRGGSAPS
                       ::                : .      .::                    

M3Y0R3_BBC3-01         PN
M3YDI3_BCL2L11-01      --
M3YAD5_BMF-01          --
M3YNE7_BAD-01          Q-
                         

© 1998-2018