Dataset for protein Noxa of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9JM54_PMAIP1-03      MPGK----------------------------------------------
Q9JM54_PMAIP1-02      MPGRKARRNAPVNPTR----------------------------------
Q9JM54_PMAIP1-01      MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQM
                      ***.                                              

Q9JM54_PMAIP1-03      ---SQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFN
Q9JM54_PMAIP1-02      ------------------ADLKDECAQLRRIGDKVNLRQKLLNLISKLFN
Q9JM54_PMAIP1-01      PGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFN
                                        ********************************

Q9JM54_PMAIP1-03      LVT
Q9JM54_PMAIP1-02      LVT
Q9JM54_PMAIP1-01      LVT
                      ***

© 1998-2019