Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A2AV74_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
Q99ML1_BBC3-02         --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
                                                                         

A2AV74_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDV
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
A2AV74_BMF-02          -------------------------------MSPGEMEPPQCVEELEDDV
Q99ML1_BBC3-02         -------MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPG
Q61337_BAD-05          -------------------------------------------------M
Q61337_BAD-04          -------------------------------------------------M
Q61337_BAD-03          -------------------------------------------------M
Q61337_BAD-06          -------------------------------------------------M
Q61337_BAD-02          -------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSM
Q61337_BAD-01          -------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSM
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
                                                                         

A2AV74_BMF-01          FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       -------------------------------------MPGRKARRNAPVN
Q9JM54_PMAIP1-01       -------------------------------------MPGRKARRNAPVN
O70337_BIK-01          ---------------------------MSEARLMARDVIKTVPHDQVPQP
O70337_BIK-02          ---------------------------MSEARLMARDVIKTVPHDQVPQP
O70337_BIK-04          --------------------------------------------------
A2AV74_BMF-02          FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
Q99ML1_BBC3-02         LPAAPAAPALLPA-------------------------AYLCAPTAPPAV
Q61337_BAD-05          FQIPEFEPSEQED-------------------------ASATDRGLGPSL
Q61337_BAD-04          FQIPEFEPSEQED-------------------------ASATDRGLGPSL
Q61337_BAD-03          FQIPEFEPSEQED-------------------------ASATDRGLGPSL
Q61337_BAD-06          FQIPEFEPSEQED-------------------------ASATDRGLGPSL
Q61337_BAD-02          FQIPEFEPSEQED-------------------------ASATDRGLGPSL
Q61337_BAD-01          FQIPEFEPSEQED-------------------------ASATDRGLGPSL
P62816_HRK-03          --------------------------------------MCPCPRHRGRGP
O54918_BCL2L11-03      ---MAKQPSDV---------------------------SSECDREGGQLQ
O54918_BCL2L11-06      ---MAKQPSDV---------------------------SSECDREGGQLQ
O54918_BCL2L11-08      ---MAKQPSDV---------------------------SSECDREGGQLQ
O54918_BCL2L11-05      ---MAKQPSDV---------------------------SSECDREGGQLQ
O54918_BCL2L11-01      ---MAKQPSDV---------------------------SSECDREGGQLQ
                                                                         

A2AV74_BMF-01          QE-----DKATQTLSPASPSQGVMLPC-----------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       PTRAD---------------------------------------------
Q9JM54_PMAIP1-01       PTRAELPP------------------E-----------------------
O70337_BIK-01          PVASETPSMKEPVRDVDLMECVEGRNQ-----------------------
O70337_BIK-02          PVASETPSMKEPVRDVDLMECVEGRNQ-----------------------
O70337_BIK-04          ---------------------MFTRNQ-----------------------
A2AV74_BMF-02          QE-----DKATQTLSPASPSQGVMLPC-----------------------
Q99ML1_BBC3-02         TA-----ALGGPRWPGG-------HRS-----------------------
Q61337_BAD-05          TE-----DQPGPYLAPGLLGSNIHQQG-----------------------
Q61337_BAD-04          TE-----DQPGPYLAPGLLGSNIHQQG-----------------------
Q61337_BAD-03          TE-----DQPGPYLAPGLLGSNIHQQG-----------------------
Q61337_BAD-06          TE-----DQPGPYLAPGLLGSNIHQQG-----------------------
Q61337_BAD-02          TE-----DQPGPYLAPGLLGSNIHQQG-----------------------
Q61337_BAD-01          TE-----DQPGPYLAPGLLGSNIHQQG-----------------------
P62816_HRK-03          PAVCGCGDAR-PGLRWAAAQVTALRLQ-----------------------
O54918_BCL2L11-03      PA-----ERP-PQLRPGAPTSLQTEPQ-----------------------
O54918_BCL2L11-06      PA-----ERP-PQLRPGAPTSLQTEPQ-----------------------
O54918_BCL2L11-08      PA-----ERP-PQLRPGAPTSLQTEPQ-----------------------
O54918_BCL2L11-05      PA-----ERP-PQLRPGAPTSLQTEPQ-----------------------
O54918_BCL2L11-01      PA-----ERP-PQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPA
                                                                         

A2AV74_BMF-01          ------------------------GVTEEPQRLFYGNAGYRLPLPASFPA
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
Q9JM54_PMAIP1-01       ------------------------FAAQLRKIGDKVYCTWSAPDITVVLA
O70337_BIK-01          ------------------------VALRLACIGDEMDLCLRSPR----LV
O70337_BIK-02          ------------------------VALRLACIGDEMDLCLRSPR----LV
O70337_BIK-04          ------------------------VALRLACIGDEMDLCLRSPR----LV
A2AV74_BMF-02          ------------------------GVTEEPQRLFYGNAGYRLPLPASFPA
Q99ML1_BBC3-02         ------------------------RPRGPRPDGPQPSLSPA-QQHLESPV
Q61337_BAD-05          ------------------------RAATNSHHGGAGAMETR-SRHSSYPA
Q61337_BAD-04          ------------------------RAATNSHHGGAGAMETR-SRHSSYPA
Q61337_BAD-03          ------------------------RAATNSHHGGAGAMETR-SRHSSYPA
Q61337_BAD-06          ------------------------RAATNSHHGGAGAMETR-SRHSSYPA
Q61337_BAD-02          ------------------------RAATNSHHGGAGAMETR-SRHSSYPA
Q61337_BAD-01          ------------------------RAATNSHHGGAGAMETR-SRHSSYPA
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-03      ---------------------------------DRSPAPMSCDKSTQTPS
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-05      ---------------------------------DRSPAPMSCDKSTQTPS
O54918_BCL2L11-01      SPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS
                                                                         

A2AV74_BMF-01          GSPLGEQ------PPEGQFLQHRAEV----------QIARKLQCIADQFH
Q9JM54_PMAIP1-03       -MPGKSQKSRMRSPSPTRVPADLKDE------------CAQLRRIGDKV-
Q9JM54_PMAIP1-02       ----------------------LKDE------------CAQLRRIGDKV-
Q9JM54_PMAIP1-01       QMPGKSQKSRMRSPSPTRVPADLKDE------------CAQLRRIGDKV-
O70337_BIK-01          QLPGIAIHRLAVTYSRTGVRGIFRSL------------IRSLTNLRENIW
O70337_BIK-02          QLPGIAIHRLAVTYSRTGVRGIFRSL------------IRSLTNLRENIW
O70337_BIK-04          QLPGIAIHRLAVTYSRTGVRGIFRSL------------IRSLTNLRENIW
A2AV74_BMF-02          GSPLGEQ------PPEGQFLQHRAEV----------QIARKLQCIADQFH
Q99ML1_BBC3-02         PSAPE--------ALAGGPTQAAPGVRVEEEEW-AREIGAQLRRMADDLN
Q61337_BAD-05          GTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFE
Q61337_BAD-04          GTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFE
Q61337_BAD-03          GTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFE
Q61337_BAD-06          GTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFE
Q61337_BAD-02          GTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFE
Q61337_BAD-01          GTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFE
P62816_HRK-03          -------------------------------------------ALGDELH
O54918_BCL2L11-03      PPCQAFNHYLSAMDQLENLNQVAQNI------H------------GDAWY
O54918_BCL2L11-06      -------------ASIRQSQEEPEDL------RPEIRIAQELRRIGDEFN
O54918_BCL2L11-08      -------------ASIRQSQEEPEDL------RPEIRIAQELRRIGDEFN
O54918_BCL2L11-05      PPCQAFNHYLSAMASIRQSQEEPEDL------RPEIRIAQELRRIGDEFN
O54918_BCL2L11-01      PPCQAFNHYLSAMASIRQSQEEPEDL------RPEIRIAQELRRIGDEFN
                                                                     :   

A2AV74_BMF-01          RLHTQQ---------HQQNRDRAWWQVFLFLQNLALNRQENREGVGPW--
Q9JM54_PMAIP1-03       --------------NLRQKLLNLISKLFNLVT------------------
Q9JM54_PMAIP1-02       --------------NLRQKLLNLISKLFNLVT------------------
Q9JM54_PMAIP1-01       --------------NLRQKLLNLISKLFNLVT------------------
O70337_BIK-01          SWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ----------
O70337_BIK-02          SWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ----------
O70337_BIK-04          SWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ----------
A2AV74_BMF-02          RLHTQQ---------HQQNRDRAWWQVF--LFLQNLALNRQENREGVGPW
Q99ML1_BBC3-02         AQYERRRQE------EQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
Q61337_BAD-05          GSFKVSASVRCDGT------------------------------------
Q61337_BAD-04          GSFKGLPRPKSAGTATQMRQSAGWTRIIQSWW------DRNLGKGGSTPS
Q61337_BAD-03          GSFKGLPRPKSAGTATQMRQSAGWTRIIQSWW------DRNLGKGGSTPS
Q61337_BAD-06          GSFKGLPRPKSAGTATQMRQSAGWTRIIQSWW------DRNLGKGGSTPS
Q61337_BAD-02          GSFKG----------EELTYSLSPFRCVQ---------------------
Q61337_BAD-01          GSFKGLPRPKSAGTATQMRQSAGWTRIIQSWW------DRNLGKGGSTPS
P62816_HRK-03          RRAMRR------RARPRDPLPALLPALRARWPWLCAAAQVAALAAWLLGR
O54918_BCL2L11-03      N-------------------------------------------------
O54918_BCL2L11-06      ETYTRRVFANDYREAEDHPQMVILQLLRFIFR--------------LVWR
O54918_BCL2L11-08      ETYTRRVFANDYREAEDHPQMVILQLLRFIFR--------------LVWR
O54918_BCL2L11-05      ETYTRRVFANDYREAEDHPQMVILQLLRFIFR--------------LVWR
O54918_BCL2L11-01      ETYTRRVFANDYREAEDHPQMVILQLLRFIFR--------------LVWR
                                                                         

A2AV74_BMF-01          ---
Q9JM54_PMAIP1-03       ---
Q9JM54_PMAIP1-02       ---
Q9JM54_PMAIP1-01       ---
O70337_BIK-01          ---
O70337_BIK-02          ---
O70337_BIK-04          ---
A2AV74_BMF-02          ---
Q99ML1_BBC3-02         ---
Q61337_BAD-05          ---
Q61337_BAD-04          Q--
Q61337_BAD-03          Q--
Q61337_BAD-06          Q--
Q61337_BAD-02          ---
Q61337_BAD-01          Q--
P62816_HRK-03          RSA
O54918_BCL2L11-03      ---
O54918_BCL2L11-06      RH-
O54918_BCL2L11-08      RH-
O54918_BCL2L11-05      RH-
O54918_BCL2L11-01      RH-
                          

© 1998-2019