Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A2AV74_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
Q99ML1_BBC3-02         --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
                                                                         

A2AV74_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDV
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
A2AV74_BMF-02          -------------------------------MSPGEMEPPQCVEELEDDV
Q99ML1_BBC3-02         ------------------------------------MARARQEGSSPEPV
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-01          ------------------------------------MGTPKQPSLAPAHA
Q61337_BAD-02          ------------------------------------MGTPKQPSLAPAHA
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
                                                                         

A2AV74_BMF-01          FQSEDGEPGTQPGGLLSADL----FAQSQLDCPLSRLQLFPLTHCCGPGL
Q9JM54_PMAIP1-01       -----------------------------------------MPGRKARRN
O70337_BIK-02          -------------------------------MSEARLMARDVIKTVPHDQ
O70337_BIK-01          -------------------------------MSEARLMARDVIKTVPHDQ
O70337_BIK-04          --------------------------------------------------
A2AV74_BMF-02          FQSEDGEPGTQPGGLLSADL----FAQSQLDCPLSRLQLFPLTHCCGPGL
Q99ML1_BBC3-02         EGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTA
Q61337_BAD-03          ----------------------------MFQIPEFEPSEQEDASATDRGL
Q61337_BAD-01          LGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGL
Q61337_BAD-02          LGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGL
P62816_HRK-03          ------------------------------------------MCPCPRHR
O54918_BCL2L11-03      ----------------------------------MAKQPSDVSSECDREG
O54918_BCL2L11-08      ----------------------------------MAKQPSDVSSECDREG
O54918_BCL2L11-06      ----------------------------------MAKQPSDVSSECDREG
O54918_BCL2L11-05      ----------------------------------MAKQPSDVSSECDREG
O54918_BCL2L11-01      ----------------------------------MAKQPSDVSSECDREG
                                                                         

A2AV74_BMF-01          RPISQE----DKATQTLSPASPSQGVMLPC--------------------
Q9JM54_PMAIP1-01       APVNPT----RAELPP----------------------------------
O70337_BIK-02          VPQPPV----ASETPSMKEPVRDVDLMECV--------------------
O70337_BIK-01          VPQPPV----ASETPSMKEPVRDVDLMECV--------------------
O70337_BIK-04          -----------------------------M--------------------
A2AV74_BMF-02          RPISQE----DKATQTLSPASPSQGVMLPC--------------------
Q99ML1_BBC3-02         PPAVTA----ALGGPRWPGG-------HRS--------------------
Q61337_BAD-03          GPSLTE----DQPGPYLAPGLLGSNIHQQG--------------------
Q61337_BAD-01          GPSLTE----DQPGPYLAPGLLGSNIHQQG--------------------
Q61337_BAD-02          GPSLTE----DQPGPYLAPGLLGSNIHQQG--------------------
P62816_HRK-03          GRGPPAVCGCGDARPGLRWAAAQVTALRLQ--------------------
O54918_BCL2L11-03      GQLQPA-----ERPPQLRPGAPTSLQTEPQ--------------------
O54918_BCL2L11-08      GQLQPA-----ERPPQLRPGAPTSLQTEPQ--------------------
O54918_BCL2L11-06      GQLQPA-----ERPPQLRPGAPTSLQTEPQ--------------------
O54918_BCL2L11-05      GQLQPA-----ERPPQLRPGAPTSLQTEPQ--------------------
O54918_BCL2L11-01      GQLQPA-----ERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLA
                                                                         

A2AV74_BMF-01          ---------------------------GVTEEPQRLFYGNAGYRLPLPAS
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
A2AV74_BMF-02          ---------------------------GVTEEPQRLFYGNAGYRLPLPAS
Q99ML1_BBC3-02         ---------------------------RPRGPRPDGPQPSLSPA-QQHLE
Q61337_BAD-03          ---------------------------RAATNSHHGGAGAMETR-SRHSS
Q61337_BAD-01          ---------------------------RAATNSHHGGAGAMETR-SRHSS
Q61337_BAD-02          ---------------------------RAATNSHHGGAGAMETR-SRHSS
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-03      ------------------------------------DRSPAPMSCDKSTQ
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      ------------------------------------DRSPAPMSCDKSTQ
O54918_BCL2L11-01      PPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQ
                                                                         

A2AV74_BMF-01          FPAGSPLGEQPPEGQFLQH----------------RAEVQIARKLQCIAD
Q9JM54_PMAIP1-01       ---------------------------------------EFAAQLRKIGD
O70337_BIK-02          -----------------------------------EGRNQVALRLACIGD
O70337_BIK-01          -----------------------------------EGRNQVALRLACIGD
O70337_BIK-04          -----------------------------------FTRNQVALRLACIGD
A2AV74_BMF-02          FPAGSPLGEQ------PPEGQFLQHRAEV----------QIARKLQCIAD
Q99ML1_BBC3-02         SPVPSAPE--------ALAGGPTQAAPGVRVEEEEW-AREIGAQLRRMAD
Q61337_BAD-03          YPAGTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSD
Q61337_BAD-01          YPAGTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSD
Q61337_BAD-02          YPAGTEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSD
P62816_HRK-03          ----------------------------------------------ALGD
O54918_BCL2L11-03      TPSPPCQAFNHYLSAMDQLENLNQVAQNI------H------------GD
O54918_BCL2L11-08      ----------------ASIRQSQEEPEDL------RPEIRIAQELRRIGD
O54918_BCL2L11-06      ----------------ASIRQSQEEPEDL------RPEIRIAQELRRIGD
O54918_BCL2L11-05      TPSPPCQAFNHYLSAMASIRQSQEEPEDL------RPEIRIAQELRRIGD
O54918_BCL2L11-01      TPSPPCQAFNHYLSAMASIRQSQEEPEDL------RPEIRIAQELRRIGD
                                                                       .*

A2AV74_BMF-01          QFHRLHTQQ-----------------------------------------
Q9JM54_PMAIP1-01       KVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIG
O70337_BIK-02          EMDLCLRSPR----LVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLR
O70337_BIK-01          EMDLCLRSPR----LVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLR
O70337_BIK-04          EMDLCLRSPR----LVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLR
A2AV74_BMF-02          QFHRLHTQQ-----------------------------------------
Q99ML1_BBC3-02         DLNAQYERRR----------------------------------------
Q61337_BAD-03          EFEGSFKGLP----------------------------------------
Q61337_BAD-01          EFEGSFKGLP----------------------------------------
Q61337_BAD-02          EFEGSFKG------------------------------------------
P62816_HRK-03          ELHRRAMRR-----------------------------------------
O54918_BCL2L11-03      AWYN----------------------------------------------
O54918_BCL2L11-08      EFNETYTRRV----------------------------------------
O54918_BCL2L11-06      EFNETYTRRV----------------------------------------
O54918_BCL2L11-05      EFNETYTRRV----------------------------------------
O54918_BCL2L11-01      EFNETYTRRV----------------------------------------
                                                                         

A2AV74_BMF-01          ---------------HQQNRDRAWWQVF--LFLQNLALNRQENREGVGPW
Q9JM54_PMAIP1-01       DKV---------------NLRQKLLNLISKLFNLVT--------------
O70337_BIK-02          ENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ------
O70337_BIK-01          ENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ------
O70337_BIK-04          ENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ------
A2AV74_BMF-02          ---------------HQQNRDRAWWQVF--LFLQNLALNRQENREGVGPW
Q99ML1_BBC3-02         -------QE------EQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
Q61337_BAD-03          -------RPKSAGTATQMRQSAGWTRIIQSWW------DRNLGKGGSTPS
Q61337_BAD-01          -------RPKSAGTATQMRQSAGWTRIIQSWW------DRNLGKGGSTPS
Q61337_BAD-02          ---------------EELTYSLSPFRCVQ---------------------
P62816_HRK-03          ------------RA-RPRDPLPALLPALRARWPWLCAAAQVAALAAWLLG
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-08      -------FANDYRE-AEDHPQMVILQLLRFIFR--------------LVW
O54918_BCL2L11-06      -------FANDYRE-AEDHPQMVILQLLRFIFR--------------LVW
O54918_BCL2L11-05      -------FANDYRE-AEDHPQMVILQLLRFIFR--------------LVW
O54918_BCL2L11-01      -------FANDYRE-AEDHPQMVILQLLRFIFR--------------LVW
                                                                         

A2AV74_BMF-01          ----
Q9JM54_PMAIP1-01       ----
O70337_BIK-02          ----
O70337_BIK-01          ----
O70337_BIK-04          ----
A2AV74_BMF-02          ----
Q99ML1_BBC3-02         ----
Q61337_BAD-03          Q---
Q61337_BAD-01          Q---
Q61337_BAD-02          ----
P62816_HRK-03          RRSA
O54918_BCL2L11-03      ----
O54918_BCL2L11-08      RRH-
O54918_BCL2L11-06      RRH-
O54918_BCL2L11-05      RRH-
O54918_BCL2L11-01      RRH-
                           

© 1998-2019