Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A2AV74_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
Q99ML1_BBC3-02         --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
                                                                         

A2AV74_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDV
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
A2AV74_BMF-02          -------------------------------MSPGEMEPPQCVEELEDDV
Q99ML1_BBC3-02         ------------------------------------MARARQEGSSPEPV
Q61337_BAD-02          ------------------------------------MGTPKQPSLAPAHA
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-01          ------------------------------------MGTPKQPSLAPAHA
                                                                         

A2AV74_BMF-01          FQSEDGEPGTQPGGLLSADL----FAQSQLDCPLSRLQLFPLTHCCGPGL
Q9JM54_PMAIP1-01       -----------------------------------------MPGRKARRN
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          -------------------------------MSEARLMARDVIKTVPHDQ
O70337_BIK-02          -------------------------------MSEARLMARDVIKTVPHDQ
O70337_BIK-01          -------------------------------MSEARLMARDVIKTVPHDQ
P62816_HRK-03          ------------------------------------------MCPCPRHR
O54918_BCL2L11-01      ----------------------------------MAKQPSDVSSECDREG
O54918_BCL2L11-03      ----------------------------------MAKQPSDVSSECDREG
O54918_BCL2L11-08      ----------------------------------MAKQPSDVSSECDREG
O54918_BCL2L11-06      ----------------------------------MAKQPSDVSSECDREG
O54918_BCL2L11-05      ----------------------------------MAKQPSDVSSECDREG
A2AV74_BMF-02          FQSEDGEPGTQPGGLLSADL----FAQSQLDCPLSRLQLFPLTHCCGPGL
Q99ML1_BBC3-02         EGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTA
Q61337_BAD-02          LGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGL
Q61337_BAD-03          ----------------------------MFQIPEFEPSEQEDASATDRGL
Q61337_BAD-01          LGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGL
                                                                         

A2AV74_BMF-01          RPISQEDKATQTLSPASPSQGVMLPC------------------------
Q9JM54_PMAIP1-01       APVNPTRAELPP--------------------------------------
O70337_BIK-04          -------------------------M------------------------
O70337_BIK-03          VPQPPVASETPSMKEPVRDVDLMECV------------------------
O70337_BIK-02          VPQPPVASETPSMKEPVRDVDLMECV------------------------
O70337_BIK-01          VPQPPVASETPSMKEPVRDVDLMECV------------------------
P62816_HRK-03          GRGPPAVCGCGDARPGLRWAAAQVTA------------------------
O54918_BCL2L11-01      GQLQPAERP-PQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPAS
O54918_BCL2L11-03      GQLQPAERP-PQLRPGAPTSLQTEPQ------------------------
O54918_BCL2L11-08      GQLQPAERP-PQLRPGAPTSLQTEPQ------------------------
O54918_BCL2L11-06      GQLQPAERP-PQLRPGAPTSLQTEPQ------------------------
O54918_BCL2L11-05      GQLQPAERP-PQLRPGAPTSLQTEPQ------------------------
A2AV74_BMF-02          RPISQEDKATQTLSPASPSQGVMLPC------------------------
Q99ML1_BBC3-02         PPAVTAALGGPRWPGG-------HRS------------------------
Q61337_BAD-02          GPSLTEDQPGPYLAPGLLGSNIHQQG------------------------
Q61337_BAD-03          GPSLTEDQPGPYLAPGLLGSNIHQQG------------------------
Q61337_BAD-01          GPSLTEDQPGPYLAPGLLGSNIHQQG------------------------
                                                                         

A2AV74_BMF-01          -----------------------GVTEEPQRLFYGNAGYRLPLPASFPAG
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
O54918_BCL2L11-01      PGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSP
O54918_BCL2L11-03      --------------------------------DRSPAPMSCDKSTQTPSP
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------DRSPAPMSCDKSTQTPSP
A2AV74_BMF-02          -----------------------GVTEEPQRLFYGNAGYRLPLPASFPAG
Q99ML1_BBC3-02         -----------------------RPRGPRPDGPQPSLSPA-QQHLESPVP
Q61337_BAD-02          -----------------------RAATNSHHGGAGAMETR-SRHSSYPAG
Q61337_BAD-03          -----------------------RAATNSHHGGAGAMETR-SRHSSYPAG
Q61337_BAD-01          -----------------------RAATNSHHGGAGAMETR-SRHSSYPAG
                                                                         

A2AV74_BMF-01          SPLGEQPPEGQFLQH----------------RAEVQIARKLQCIADQFHR
Q9JM54_PMAIP1-01       -----------------------------------EFAAQLRKIGDKVYC
O70337_BIK-04          -------------------------------FTRNQVALRLACIGDEMDL
O70337_BIK-03          -------------------------------EGRNQVALRLACIGDEMDL
O70337_BIK-02          -------------------------------EGRNQVALRLACIGDEMDL
O70337_BIK-01          -------------------------------EGRNQVALRLACIGDEMDL
P62816_HRK-03          --------------------------------------LRLQALGDELHR
O54918_BCL2L11-01      PCQAFNHYLSAMASIRQSQEEPEDL------RPEIRIAQELRRIGDEFNE
O54918_BCL2L11-03      PCQAFNHYLSAMDQLENLNQVAQNI------H------------GDAWYN
O54918_BCL2L11-08      ------------ASIRQSQEEPEDL------RPEIRIAQELRRIGDEFNE
O54918_BCL2L11-06      ------------ASIRQSQEEPEDL------RPEIRIAQELRRIGDEFNE
O54918_BCL2L11-05      PCQAFNHYLSAMASIRQSQEEPEDL------RPEIRIAQELRRIGDEFNE
A2AV74_BMF-02          SPLGEQ------PPEGQFLQHRAEV----------QIARKLQCIADQFHR
Q99ML1_BBC3-02         SAPE--------ALAGGPTQAAPGVRVEEEEW-AREIGAQLRRMADDLNA
Q61337_BAD-02          TEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEG
Q61337_BAD-03          TEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEG
Q61337_BAD-01          TEEDEGMEEELSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEG
                                                                   .*    

A2AV74_BMF-01          LHTQQH------------QQNRDRAWWQVFLFLQNLALNRQENREGVGPW
Q9JM54_PMAIP1-01       TWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKV-
O70337_BIK-04          CLRSPR----LVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIW
O70337_BIK-03          CLRSPR----LVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIW
O70337_BIK-02          CLRSPR----LVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIW
O70337_BIK-01          CLRSPR----LVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIW
P62816_HRK-03          RAMRRR----A-------RPRDPLPALLPALRARWPWLCAAAQVAALAAW
O54918_BCL2L11-01      TYTRRV----FANDYRE-AEDHPQMVILQLLRFIFRLVWRRH--------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-08      TYTRRV----FANDYRE-AEDHPQMVILQLLRFIFRLVWRRH--------
O54918_BCL2L11-06      TYTRRV----FANDYRE-AEDHPQMVILQLLRFIFRLVWRRH--------
O54918_BCL2L11-05      TYTRRV----FANDYRE-AEDHPQMVILQLLRFIFRLVWRRH--------
A2AV74_BMF-02          LHTQQ-------------HQQNRDRAWWQVF--LFLQNLALNRQENREGV
Q99ML1_BBC3-02         QYERRR----QE------EQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEM
Q61337_BAD-02          SFKG--------------EELTYSLSPFRCVQ------------------
Q61337_BAD-03          SFKGLP----RPKSAGTATQMRQSAGWTRIIQSWW------DRNLGKGGS
Q61337_BAD-01          SFKGLP----RPKSAGTATQMRQSAGWTRIIQSWW------DRNLGKGGS
                                                                         

A2AV74_BMF-01          ----------------------------------------
Q9JM54_PMAIP1-01       --------------NLRQKLLNLISKLFNLVT--------
O70337_BIK-04          SWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
O70337_BIK-03          SWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGG-------
O70337_BIK-02          SWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
O70337_BIK-01          SWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
P62816_HRK-03          LLGRRSA---------------------------------
O54918_BCL2L11-01      ----------------------------------------
O54918_BCL2L11-03      ----------------------------------------
O54918_BCL2L11-08      ----------------------------------------
O54918_BCL2L11-06      ----------------------------------------
O54918_BCL2L11-05      ----------------------------------------
A2AV74_BMF-02          GPW-------------------------------------
Q99ML1_BBC3-02         EPN-------------------------------------
Q61337_BAD-02          ----------------------------------------
Q61337_BAD-03          TPSQ------------------------------------
Q61337_BAD-01          TPSQ------------------------------------
                                                               

© 1998-2018