Dataset for protein Bmf of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A2AV74_BMF-01      MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQAPRVF
A2AV74_BMF-02      ------------------------------------------------------------
                                                                               

A2AV74_BMF-01      FTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADL
A2AV74_BMF-02      ---------------------MSPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADL
                                          *************************************

A2AV74_BMF-01      FAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQR
A2AV74_BMF-02      FAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQR
                   ************************************************************

A2AV74_BMF-01      LFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
A2AV74_BMF-02      LFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
                   ************************************************************

A2AV74_BMF-01      QNRDRAWWQVFLFLQNLALNRQENREGVGPW
A2AV74_BMF-02      QNRDRAWWQVFLFLQNLALNRQENREGVGPW
                   *******************************

© 1998-2018