Dataset for protein Bik of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O70337_BIK-04      --------------------------------------------MFTRNQVALRLACIGD
O70337_BIK-03      MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGD
O70337_BIK-02      MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGD
O70337_BIK-01      MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGD
                                                               :  *************

O70337_BIK-04      EMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAW
O70337_BIK-03      EMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAW
O70337_BIK-02      EMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAW
O70337_BIK-01      EMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAW
                   ************************************************************

O70337_BIK-04      VSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
O70337_BIK-03      VSPDQDPGQLFPMVLLVFLLLGG-------
O70337_BIK-02      VSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
O70337_BIK-01      VSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
                   ***********************       

© 1998-2018