Dataset for protein Bim of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O54918_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDR
O54918_BCL2L11-03      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
O54918_BCL2L11-08      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
O54918_BCL2L11-06      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
O54918_BCL2L11-05      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
                       *****************************************         

O54918_BCL2L11-01      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
O54918_BCL2L11-03      -----------------------------------------------DRS
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      -----------------------------------------------DRS
                                                                         

O54918_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQEL
O54918_BCL2L11-03      PAPMSCDKSTQTPSPPCQAFNHYLSAMDQLENLNQVAQNIH---------
O54918_BCL2L11-08      ---------------------------ASIRQSQEEPEDLRPEIRIAQEL
O54918_BCL2L11-06      ---------------------------ASIRQSQEEPEDLRPEIRIAQEL
O54918_BCL2L11-05      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQEL
                                                   .: : :: .:::.         

O54918_BCL2L11-01      RRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
O54918_BCL2L11-03      ---GDAWYN-------------------------------------
O54918_BCL2L11-08      RRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
O54918_BCL2L11-06      RRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
O54918_BCL2L11-05      RRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
                          ** : :                                     

© 1998-2018