Dataset for protein Bad of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q61337_BAD-05      ------------------------------------------MFQIPEFEPSEQEDASAT
Q61337_BAD-04      ------------------------------------------MFQIPEFEPSEQEDASAT
Q61337_BAD-03      ------------------------------------------MFQIPEFEPSEQEDASAT
Q61337_BAD-06      ------------------------------------------MFQIPEFEPSEQEDASAT
Q61337_BAD-02      MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
Q61337_BAD-01      MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
                                                             ******************

Q61337_BAD-05      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-04      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-03      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-06      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-02      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-01      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
                   ************************************************************

Q61337_BAD-05      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKVSASVRCDGT-------
Q61337_BAD-04      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
Q61337_BAD-03      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
Q61337_BAD-06      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
Q61337_BAD-02      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKG----------EELTYS
Q61337_BAD-01      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
                   *******************************************                 

Q61337_BAD-05      ------------------------
Q61337_BAD-04      AGWTRIIQSWWDRNLGKGGSTPSQ
Q61337_BAD-03      AGWTRIIQSWWDRNLGKGGSTPSQ
Q61337_BAD-06      AGWTRIIQSWWDRNLGKGGSTPSQ
Q61337_BAD-02      LSPFRCVQ----------------
Q61337_BAD-01      AGWTRIIQSWWDRNLGKGGSTPSQ
                                           

© 1998-2019