Dataset for protein classical BH3-containing proteins of organism Monopterus albus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3K6I5_BCL2L11      MHLSRPPNRSDGSTAVTATEESGDPPSVGAAGTSAQSSRSNGGSERSFGH
A0A3Q3QZ16_BMF-01       ---------MDDEEDDVFEPDP----------------------------
A0A3Q3QZ16_BMF-02       ---------MDDEEDDVFEPDP----------------------------
A0A3Q3R5S3_BAD-01       MAANFTISDSESESSEEVEEGK----------------------------
                                  :..                                     

A0A3Q3K6I5_BCL2L11      PGSAGGGEPVSPSRCRTKAIAPLDSLSVFHTRSIFHLPRRSSSGYFSNDS
A0A3Q3QZ16_BMF-01       ----------------------------HCWRTAFREIKCEDRGTQTAGP
A0A3Q3QZ16_BMF-02       ----------------------------HCWRTAFREIKCEDRGTQTAGP
A0A3Q3R5S3_BAD-01       ----------------------------H------------------SQS
                                                    .                    .

A0A3Q3K6I5_BCL2L11      DSVPSSPLSPRPVTAD-KVTQTPSPSSQVMNHALQCMAEAHGGRPGTHRQ
A0A3Q3QZ16_BMF-01       TLAPNNSMLPCGVAEDPRPLFYGNAGFRLHFPAHFELV----GDQEARRQ
A0A3Q3QZ16_BMF-02       TLAPNNSMLPCGVAEDPRPLFYGNAGFRLHFPAHFELV----GDQEARRQ
A0A3Q3R5S3_BAD-01       STSQEQQVPPCHSLTLPELRMAATSRNRVSSESNASTVQDAKSDEEAGTP
                            .. : *             ..  .:   :    .    .   :   

A0A3Q3K6I5_BCL2L11      DASSPSPSSARQQNAIRDMQAEAVGRELRRIGDDYNNHLLELADRRRRVV
A0A3Q3QZ16_BMF-01       EDQNGMEHLPRQQRVARSVEA-CIGQKLQLIGDQFHREHLQLYHRNQRNQ
A0A3Q3QZ16_BMF-02       EDQNGMEHLPRQQRVARSVEA-CIGQKLQLIGDQFHREHLQLYHRNQRNQ
A0A3Q3R5S3_BAD-01       TDGAPFRGRSKSAPPALWAAK-KYGRQLRRMSDEFDSLLDKGEMKRVRSA
                                 ...            *.:*. :.*::     :   .. *  

A0A3Q3K6I5_BCL2L11      PRI----HQELTIVLCVGILVLVIGQIILQGSINSQDNSQV---------
A0A3Q3QZ16_BMF-01       GPL--------WWRLATTLLSLLFDRGFIAGGGGAGRR------------
A0A3Q3QZ16_BMF-02       GPL--------WWRLATTLLSLLFDRGFIAGGGGAGRR------------
A0A3Q3R5S3_BAD-01       GAASQMHHSKSWW-------SYLFSHQETEGENTHHENAALAQEVERVVS
                                              ::..    *      .            

© 1998-2019