Dataset for protein Bmf of organism Monopterus albus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3QZ16_BMF-01      MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAE
A0A3Q3QZ16_BMF-02      MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAE
                       **************************************************

A0A3Q3QZ16_BMF-01      DPRPLFYGNAGFRLHFPAHFELVGDQEARRQEDQNGMEHLPRQQRVARSV
A0A3Q3QZ16_BMF-02      DPRPLFYGNAGFRLHFPAHFELVGDQEARRQEDQNGMEHLPRQQRVARSV
                       **************************************************

A0A3Q3QZ16_BMF-01      EACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLATTLLSLLFDRGF
A0A3Q3QZ16_BMF-02      EACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLATTLLSLLFDRGF
                       **************************************************

A0A3Q3QZ16_BMF-01      IAGGGGAGRR
A0A3Q3QZ16_BMF-02      IAGGGGAGRR
                       **********

© 1998-2019