Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7G1G0_HRK-01          --------------------------------------------------
K7E5Y2_BBC3-01         VRLGEAPGKPLSPGCGSGQRGPGGAGSGGAGRGGGSRSRRRSLSSPALAS
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

F7G1G0_HRK-01          --------------------------------------------------
K7E5Y2_BBC3-01         PNCLGADGCRRAGAGGGSGAGRSVTSRGSRGARLQREAAAAAAAAEPAWE
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

F7G1G0_HRK-01          --------------------------------------------------
K7E5Y2_BBC3-01         PAAQDTCVRPAGATAGAGAGAVASGGGDRGGGSSSSSSSSSSSSSSRGSS
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

F7G1G0_HRK-01          --------------------------------------------------
K7E5Y2_BBC3-01         RGSGGEQAARSQAPPGRPGPRLTAPQARPRRRVHAPGGLGVGLRSGECAP
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

F7G1G0_HRK-01          --------------------------------------------------
K7E5Y2_BBC3-01         RLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARGVAPPLTCSAHLS
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

F7G1G0_HRK-01          -------------------MCPCPLHRGRGPPAVCACSSDRLEQRAAAAA
K7E5Y2_BBC3-01         VSLRRLPPHWGMARAQQD-GSSPEPVEGLPRESPRTFPLGRLMPSAVSCS
F6X3N6_BMF-01          --------------------------------MEPPHYVEEL--------
F7CXT2_BCL2L11-01      -----------MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSI
K7E5Y2_BBC3-02         -----------MARAQQD-GSSPEPVEGLPRESPRTFPLGRLMPSAVSCS
                                                          .     *        

F7G1G0_HRK-01          QLTAARLKALGDELQERT--------------------------------
K7E5Y2_BBC3-01         LCE-AGLNPSGDSMCPAP--GPALAPSSLLPLAYFCTRQ-----------
F6X3N6_BMF-01          ----------EDDVFHPEDSEPGAQPGGLTSAALFAQSQPDYMLDGLQLF
F7CXT2_BCL2L11-01      QTQYQGNSGEGDSCSPSSPQGPFAPPTSPSP---FATRSPLFIFLRRSPL
K7E5Y2_BBC3-02         LCE-AGLNPSGDSMCPAP--GPALAPSSLLPLAYFCTRQ-----------
                                  *.                                     

F7G1G0_HRK-01          --------MWRRRARSRRAAAEA---------------------------
K7E5Y2_BBC3-01         -PRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQG--
F6X3N6_BMF-01          PLTHCCGP----GLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLF
F7CXT2_BCL2L11-01      LPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQ--
K7E5Y2_BBC3-02         -PRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQG--
                                     **                                  

F7G1G0_HRK-01          ------AGSGGGGLPAYWAWLCAAAH------------------VAALAA
K7E5Y2_BBC3-01         ------ASPMSGGPPGVLG----PEHGDQGEQQDREIGAQLRRMADDLNA
F6X3N6_BMF-01          YGNAGYRLPLPASFPASLRLGEEPPEEQWEHRAEVQIAQKLQCIADQFHR
F7CXT2_BCL2L11-01      ------SQSI----PADMR----PEIW---------IAQELRRIGDEFNA
K7E5Y2_BBC3-02         ------ASPMSGGPPGVLG----PEHGDQGEQQDREIGAQLRRMADDLNA
                               .     *.       .                       :  

F7G1G0_HRK-01          WLLRRRNL------------------------------------------
K7E5Y2_BBC3-01         LYEQRR-------REEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
F6X3N6_BMF-01          LHMQRH----------QQNRNHVWWQILLFLHNLALNRE--ENRNGAGPR
F7CXT2_BCL2L11-01      SYYPRRGFLDNNYQGAGDHHQMVILRLLRYIIRLVWRMQ-----------
K7E5Y2_BBC3-02         LYEQRR-------REEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
                           *.                                            

© 1998-2019