Dataset for protein classical BH3-containing proteins of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7E5Y2_BBC3-01         VRLGEAPGKPLSPGCGSGQRGPGGAGSGGAGRGGGSRSRRRSLSSPALAS
F7G1G0_HRK-01          --------------------------------------------------
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

K7E5Y2_BBC3-01         PNCLGADGCRRAGAGGGSGAGRSVTSRGSRGARLQREAAAAAAAAEPAWE
F7G1G0_HRK-01          --------------------------------------------------
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

K7E5Y2_BBC3-01         PAAQDTCVRPAGATAGAGAGAVASGGGDRGGGSSSSSSSSSSSSSSRGSS
F7G1G0_HRK-01          --------------------------------------------------
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

K7E5Y2_BBC3-01         RGSGGEQAARSQAPPGRPGPRLTAPQARPRRRVHAPGGLGVGLRSGECAP
F7G1G0_HRK-01          --------------------------------------------------
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

K7E5Y2_BBC3-01         RLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARGVAPPLTCSAHLS
F7G1G0_HRK-01          --------------------------------------------------
F6X3N6_BMF-01          --------------------------------------------------
F7CXT2_BCL2L11-01      --------------------------------------------------
K7E5Y2_BBC3-02         --------------------------------------------------
                                                                         

K7E5Y2_BBC3-01         VSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSL
F7G1G0_HRK-01          --------------------------------------------------
F6X3N6_BMF-01          -------------------------------MEPPHYVEEL---------
F7CXT2_BCL2L11-01      ----------MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQ
K7E5Y2_BBC3-02         ----------MARAQQD-GSSPEPVEGLPRESPRTFPLGRLMPSAVSCSL
                                                                         

K7E5Y2_BBC3-01         CE-AGLNPSGDSMCPAP--GPALAPSSLLPLAYFCTRQ------------
F7G1G0_HRK-01          --------------------------------------------------
F6X3N6_BMF-01          ---------EDDVFHPEDSEPGAQPGGLTSAALFAQSQPDYMLDGLQLFP
F7CXT2_BCL2L11-01      TQYQGNSGEGDSCSPSSPQGPFAPPTSPSP---FATRSPLFIFLRRSPLL
K7E5Y2_BBC3-02         CE-AGLNPSGDSMCPAP--GPALAPSSLLPLAYFCTRQ------------
                                                                         

K7E5Y2_BBC3-01         PRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQG---
F7G1G0_HRK-01          -------------MCPCPLHRGRG--------------------------
F6X3N6_BMF-01          LTHCCGP----GLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFY
F7CXT2_BCL2L11-01      PRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQ---
K7E5Y2_BBC3-02         PRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQG---
                                     .                                   

K7E5Y2_BBC3-01         -----ASPMSGGPPGVLG----PEHGDQGEQQDREIGAQLRRMADDLNAL
F7G1G0_HRK-01          -------------PPAVCACSSDRLEQRAAAAAQLTAARLKALGDELQER
F6X3N6_BMF-01          GNAGYRLPLPASFPASLRLGEEPPEEQWEHRAEVQIAQKLQCIADQFHRL
F7CXT2_BCL2L11-01      -----SQSI----PADMR----PEIW---------IAQELRRIGDEFNAS
K7E5Y2_BBC3-02         -----ASPMSGGPPGVLG----PEHGDQGEQQDREIGAQLRRMADDLNAL
                                    *  :                   .  *. :.*:::  

K7E5Y2_BBC3-01         YEQRR-------REEEQRRH----LSPWRLLYNLISGLLAPQRRNRMPDV
F7G1G0_HRK-01          TMWRRRARSRRAAAEAAGSGGGGLPAYWAWLCAAAHVAALAAWLLRRRNL
F6X3N6_BMF-01          HMQRH----------QQNRN----HVWWQILLFLHNLALNRE--ENRNGA
F7CXT2_BCL2L11-01      YYPRRGFLDNNYQGAGDHHQ----MVILRLLRYIIRLVWRMQ--------
K7E5Y2_BBC3-02         YEQRR-------REEEQRRH----LSPWRLLYNLISGLLAPQRRNRMPDV
                          *.                         *                   

K7E5Y2_BBC3-01         EPN
F7G1G0_HRK-01          ---
F6X3N6_BMF-01          GPR
F7CXT2_BCL2L11-01      ---
K7E5Y2_BBC3-02         EPN
                          

© 1998-2018