Dataset for protein Puma of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7E5Y2_BBC3-01      VRLGEAPGKPLSPGCGSGQRGPGGAGSGGAGRGGGSRSRRRSLSSPALASPNCLGADGCR
K7E5Y2_BBC3-02      ------------------------------------------------------------
                                                                                

K7E5Y2_BBC3-01      RAGAGGGSGAGRSVTSRGSRGARLQREAAAAAAAAEPAWEPAAQDTCVRPAGATAGAGAG
K7E5Y2_BBC3-02      ------------------------------------------------------------
                                                                                

K7E5Y2_BBC3-01      AVASGGGDRGGGSSSSSSSSSSSSSSRGSSRGSGGEQAARSQAPPGRPGPRLTAPQARPR
K7E5Y2_BBC3-02      ------------------------------------------------------------
                                                                                

K7E5Y2_BBC3-01      RRVHAPGGLGVGLRSGECAPRLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARGVA
K7E5Y2_BBC3-02      ------------------------------------------------------------
                                                                                

K7E5Y2_BBC3-01      PPLTCSAHLSVSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSL
K7E5Y2_BBC3-02      ---------------------MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSL
                                         ***************************************

K7E5Y2_BBC3-01      CEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGGPRWARAARSPAAGNQGQSG
K7E5Y2_BBC3-02      CEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGGPRWARAARSPAAGNQGQSG
                    ************************************************************

K7E5Y2_BBC3-01      SLPSLGPRSAQEEGGQEGEPQGASPMSGGPPGVLGPEHGDQGEQQDREIGAQLRRMADDL
K7E5Y2_BBC3-02      SLPSLGPRSAQEEGGQEGEPQGASPMSGGPPGVLGPEHGDQGEQQDREIGAQLRRMADDL
                    ************************************************************

K7E5Y2_BBC3-01      NALYEQRRREEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
K7E5Y2_BBC3-02      NALYEQRRREEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
                    *********************************************

© 1998-2019