Dataset for protein classical BH3-containing proteins of organism Mola mola

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3VLX6_BMF-01      ---------------------------MDDDEDDVFE------PEAHCWR
A0A3Q3WTY4_BAD-01      MATNFTISSDSESELSEEIEEGENSQLQTEQEQQVFQRHTLTLPELRMAG
                                                    ::*::**:      ** .   

A0A3Q3VLX6_BMF-01      TTFREIKCEDRGTQTPGPALAPYSGMLPCGVAEEPRHLFYVTSSLAPDSR
A0A3Q3WTY4_BAD-01      RTLQVKGEDEAGTPTDG---APFRGR------------------------
                        *:.    :: ** * *   **: *                         

A0A3Q3VLX6_BMF-01      DNCRERNGMERLPRQQPVAHSVEACIGQKLQLIGDQFHREHMQLYH---R
A0A3Q3WTY4_BAD-01      ------------SKSAPPSLWAAKKYGQRLRRMSDEFDRQEWKTRSAGTA
                                   ... * :  .    **.*. :.*:* *:  :       

A0A3Q3VLX6_BMF-01      NQRNQGPLWWRLGSALLSLLFDRGFFAGGGGAGRR------
A0A3Q3WTY4_BAD-01      TQMHQSRSWW-------SYLFSHQETDGENNHHDSHTHRNE
                       .* :*.  **       * **..    * ..          

© 1998-2019