Dataset for protein classical BH3-containing proteins of organism Mesocricetus auratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U8CPE0_BMF-01       -----MEPPQCVEELEDDVFQSEDGEPG-----TQPGSL-----------
A0A1U8BW10_BCL2L11      ------MAKQPSDVSSECDREGGQLQPA-----ERPPQL-----------
A0A1U8BW10_BCL2L11      ------MAKQPSDVSSECDREGGQLQPA-----ERPPQL-----------
A0A1U8CPE0_BMF-02       IFPGEMEPPQCVEELEDDVFQSEDGEPG-----TQPGSL-----------
A0A1U7Q4V0_BAD-01       -----MGTPKQPSLAPAHALGVRKSDPG-----IRSLGN----------D
A0A1U7R5N5_BBC3-01      -----MARARQEGSSPEPVEGLARDSPR-----PFPLGRLVPSAVSCGLC
A0A1U7QLK6_PMAIP1-      ------MLQSVARQNAPSNPARAELAP------EFIAQL----RRIGDKL
A0A1U7R468_HRK-01       --------------MCPCPRHRGHGPPAVCGCGDTRPGL----R------
A0A1U8BW10_BCL2L11      ------MAKQPSDVSSECDREGGQLQPA-----ERPPQL----R------
                                                  *                       

A0A1U8CPE0_BMF-01       ---LSADPFAQSQLDCPLS-----RLQLFPLTHCCGPGLRPISQEDKATQ
A0A1U8BW10_BCL2L11      ------RPGAPTSLQTEQQ-------------------------------
A0A1U8BW10_BCL2L11      ------RPGAPTSLQTEQQGNPDGEGDRCPHGSPQGPLAPPASPGPSATR
A0A1U8CPE0_BMF-02       ---LSADPFAQSQLDCPLS-----RLQLFPLTHCCGPGLRPISQEDKATQ
A0A1U7Q4V0_BAD-01       AGGRRRRPAAQSMFQIPEF-----EPSEQEDSNTADRGLGPSLTGDP---
A0A1U7R5N5_BBC3-01      EPGLPAAPAAPALLPAAYL-----CAPTAPPAVTAALG-GPRWPGGPRSR
A0A1U7QLK6_PMAIP1-      SSEWCEPDIIAVLAEMPGK-------------------------------
A0A1U7R468_HRK-01       ---WAAAQVTALRLQALGD-------------------------------
A0A1U8BW10_BCL2L11      ---PGAPT----SLQTEQQ-------------------------------
                                                                          

A0A1U8CPE0_BMF-01       TLSPASPSQGVMLPCGV--------TEEPQRLFYGNAGYRLPLPAS----
A0A1U8BW10_BCL2L11      -------------------------DRSPAPMSCDKSTQTPSPPCQAFNH
A0A1U8BW10_BCL2L11      SPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH
A0A1U8CPE0_BMF-02       TLSPASPSQGVMLPCGV--------TEEPQRLFYGNAGYRLPLPAS----
A0A1U7Q4V0_BAD-01       --------PGPCLAPGLLGNIRHQQEQAANSSHHGGTGAMETRSRH----
A0A1U7R5N5_BBC3-01      PRGPRPDGPQPSLSPA---------QQHLESPVPSAPEALAGGPTQ----
A0A1U7QLK6_PMAIP1-      -------------------------KARKSVTRIPSPTRVPTDVEDECVH
A0A1U7R468_HRK-01       -------------------------ELHRRAMRRRARPRDPLPA------
A0A1U8BW10_BCL2L11      -------------------------DRSPAPMSCDKSTQTPSPPCQAFNH
                                                                          

A0A1U8CPE0_BMF-01       ---FPAGLPLGEQP----------------PEGQWQHRAEVQIARKLQCI
A0A1U8BW10_BCL2L11      YLSAMASIRQSQEE------------PADIRPEIWIAQ-------ELRRI
A0A1U8BW10_BCL2L11      YLSAMASIRQSQEE------------PADIRPEIWIAQ-------ELRRI
A0A1U8CPE0_BMF-02       ---FPAGLPLGEQP----------------PEGQWQHRAEVQIARKLQCI
A0A1U7Q4V0_BAD-01       ---SSYTAGNEEDEGMEEELSPFRGRSRSAPPNLWAAQ---RYGRELRRM
A0A1U7R5N5_BBC3-01      ---AAPGVRGEEEE--------------------W-AR---EIGAQLRRM
A0A1U7QLK6_PMAIP1-      QLRRIGDKQNLRQK--------------------LLNFISKLFSLVT---
A0A1U7R468_HRK-01       ------LLPALRAR--------------------WPWLCAAAQVAALAAW
A0A1U8BW10_BCL2L11      YLSAMDLCENLKHE--------------------WQIHGDQSKS------
                                                                          

A0A1U8CPE0_BMF-01       ADQFH---------RLHIQQHQQNRDRAWWQVF-LFLQNLALNREENREG
A0A1U8BW10_BCL2L11      GDEFNESYRRRVNNYQEDEDHPHHPQMVILQLL-RFIVRLVWRRH-----
A0A1U8BW10_BCL2L11      GDEFNESYRRRVNNYQEDEDHPHHPQMVILQLL-RFIVRLVWRRH-----
A0A1U8CPE0_BMF-02       ADQFH---------RLHIQQHQQNRDRAWWQVF-LFLQNLALNREENREG
A0A1U7Q4V0_BAD-01       SDEFEGSFKGLPRPKSAGTATQMRQSASWTRIIQSW-----WDRNLGKGG
A0A1U7R5N5_BBC3-01      ADDLNAQYE-----RRRQEEQHRHRPSPWRVMYNLFMGLLPLPRDPGAPE
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
A0A1U7R468_HRK-01       LLGRRSA-------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
                                                                          

A0A1U8CPE0_BMF-01       VGPW-
A0A1U8BW10_BCL2L11      -----
A0A1U8BW10_BCL2L11      -----
A0A1U8CPE0_BMF-02       VGPW-
A0A1U7Q4V0_BAD-01       STPSQ
A0A1U7R5N5_BBC3-01      MEPN-
A0A1U7QLK6_PMAIP1-      -----
A0A1U7R468_HRK-01       -----
A0A1U8BW10_BCL2L11      -----
                             

© 1998-2018