Dataset for protein Bmf of organism Mesocricetus auratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U8CPE0_BMF-02      IFPGEMEPPQCVEELEDDVFQSEDGEPGTQPGSLLSADPFAQSQLDCPLS
A0A1U8CPE0_BMF-01      -----MEPPQCVEELEDDVFQSEDGEPGTQPGSLLSADPFAQSQLDCPLS
                            *********************************************

A0A1U8CPE0_BMF-02      RLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRL
A0A1U8CPE0_BMF-01      RLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRL
                       **************************************************

A0A1U8CPE0_BMF-02      FYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFH
A0A1U8CPE0_BMF-01      FYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFH
                       **************************************************

A0A1U8CPE0_BMF-02      RLHIQQHQQNRDRAWWQVFLFLQNLALNREENREGVGPW
A0A1U8CPE0_BMF-01      RLHIQQHQQNRDRAWWQVFLFLQNLALNREENREGVGPW
                       ***************************************

© 1998-2018