Dataset for protein Bim of organism Mesocricetus auratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U8BW10_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A1U8BW10_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPDGEGDR
A0A1U8BW10_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
                        *****************************************         

A0A1U8BW10_BCL2L11      -----------------------------------------------DRS
A0A1U8BW10_BCL2L11      CPHGSPQGPLAPPASPGPSATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A1U8BW10_BCL2L11      -----------------------------------------------DRS
                                                                       ***

A0A1U8BW10_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMDLCENLKHE--------------
A0A1U8BW10_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQEL
A0A1U8BW10_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQEL
                        ***************************    : : *              

A0A1U8BW10_BCL2L11      -------------------------------------------WQIHGDQ
A0A1U8BW10_BCL2L11      RRIGDEFNESYRRRVNNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH---
A0A1U8BW10_BCL2L11      RRIGDEFNESYRRRVNNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH---
                                                                   *. *   

A0A1U8BW10_BCL2L11      SKS
A0A1U8BW10_BCL2L11      ---
A0A1U8BW10_BCL2L11      ---
                           

© 1998-2018