Dataset for protein classical BH3-containing proteins of organism Meleagris gallopavo

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1MV54_BCL2L11-01      ----------------------------------------------FLLC
G1NHG8_BMF-01          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                                                                        *

G1MV54_BCL2L11-01      AASRWRSHSLAE--------------------------------------
G1NHG8_BMF-01          LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                         .*:. ..*:                                       

G1MV54_BCL2L11-01      ----------------------------------EIQPEIWIAQELRRIG
G1NHG8_BMF-01          RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
                                                         * ..*:.**.:*. *.

G1MV54_BCL2L11-01      DEFNASYCPRRGFLDNHAGNPQVVILRLLHYIIRLIWRMQ---------
G1NHG8_BMF-01          DQFH------RLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
                       *:*:      * .::.*  * : *  .*: :: .*  .::         

© 1998-2018