Dataset for protein classical BH3-containing proteins of organism Maylandia zebra

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9DPJ5_BMF-02      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
A0A3P9DPJ5_BMF-01      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
A0A3P9B2E4_BAD-01      ---------------MAANFKISDSDSEASEEVGEG----ENQQSAGQAQ
                                        :.*.  ..:  .::  * .    :.  ..* *:

A0A3P9DPJ5_BMF-02      EPRPLFYGNAGFRLHFPARFELVGDHRASRQGSTE--------------Q
A0A3P9DPJ5_BMF-01      EPRPLFYGNAGFRLHFPARFELVGDHRASRQGSTE--------------Q
A0A3P9B2E4_BAD-01      ESKPQTLSLPVTKTTAAGRLRVNSESHTSSIARDEELMARGEDEVCTPTE
                       *..*   . .  .   ..*: : .: .:*  .  *              :

A0A3P9DPJ5_BMF-02      QNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPM
A0A3P9DPJ5_BMF-01      QNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPM
A0A3P9B2E4_BAD-01      GDPFRRRSKSAPPALWAAKKYGRQLRRMSDEF------------------
                        :.: * ... *.*  .    *.:*. :.*:*                  

A0A3P9DPJ5_BMF-02      WWRLAAAILSLLFDRGFIAGGGGGGRR
A0A3P9DPJ5_BMF-01      WWRLAAAILSLLFDRGFIAGGGGGGRR
A0A3P9B2E4_BAD-01      ---------DSLLDKGVRMGVSQGLN-
                                . *:*.*.  * . * . 

© 1998-2019