Dataset for protein Bmf of organism Maylandia zebra

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9DPJ5_BMF-02      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
A0A3P9DPJ5_BMF-01      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
                       **************************************************

A0A3P9DPJ5_BMF-02      EPRPLFYGNAGFRLHFPARFELVGDHRASRQGSTEQQNSMERLPRQRPAA
A0A3P9DPJ5_BMF-01      EPRPLFYGNAGFRLHFPARFELVGDHRASRQGSTEQQNSMERLPRQRPAA
                       **************************************************

A0A3P9DPJ5_BMF-02      RSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFD
A0A3P9DPJ5_BMF-01      RSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFD
                       **************************************************

A0A3P9DPJ5_BMF-02      RGFIAGGGGGGRR
A0A3P9DPJ5_BMF-01      RGFIAGGGGGGRR
                       *************

© 1998-2019