Dataset for protein classical BH3-containing proteins of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3SYA1_BCL2L11      --------MATEESGDPPAGDPRVSAQTSRSNGGTDQ------SSVSPSR
A0A3Q3RXS8_BAD-02       MAAKFSISESESDSSEEVEGGKQKKSSARQEQQVSQR------HALAL--
A0A3Q3RXS8_BAD-01       MAAKFSISESESDSSEEVEGGKQKKSSARQEQQVSQR------HALAL--
A0A3Q3LME3_BMF-01       ---------MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNN
A0A3Q3LME3_BMF-02       ---------MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNN
A0A3Q3LME3_BMF-03       ---------MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNN
                                   .:..:    . .    : ..    :.       :::   

A0A3Q3SYA1_BCL2L11      GRTRSIAHLDSLSVFHTRSIFQLPRRSSSGYFSSDGDSLPSSPLSPRPVT
A0A3Q3RXS8_BAD-02       ------------PELRTTASNRIRLSSESQSRVDEEAGTP---TDGAPFR
A0A3Q3RXS8_BAD-01       ------------PELRTTASNRIRLSSESQSRVDEEAGTP---TDGAPFR
A0A3Q3LME3_BMF-01       GMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQQEREEEQNRME
A0A3Q3LME3_BMF-02       GMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQQEREEEQNRME
A0A3Q3LME3_BMF-03       GMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQQEREEEQNRME
                                    . :   :  .:   :      .:         .   . 

A0A3Q3SYA1_BCL2L11      ADKATQTPSL-TSQVMNHALQRLAEAHGGGAGAHRQHGEHKHLRSR----
A0A3Q3RXS8_BAD-02       GRSKSAPPALWAAKKYGQQLRRMSDEF--DSLLDKGEMRVRNAGKAQKMH
A0A3Q3RXS8_BAD-01       GRSKSAPPALWAAKKYGQQLRRMSDEF--DSLLDKGEMRVRNAGKAQKMH
A0A3Q3LME3_BMF-01       QLPRQQPLVHSVEACIGQKLQLIGDQF------HREHLQL----------
A0A3Q3LME3_BMF-02       QLPRQQPLVHSVEACIGQKLQLIGDQF------HREHLQLYHLNQR---N
A0A3Q3LME3_BMF-03       QLPRQQPLVHSVEACIGQKLQLIGDQF------HREHLQLYHLNQR---N
                              .    .    .: *. :.: .       .               

A0A3Q3SYA1_BCL2L11      ---------------LFTA----------HAEYTQVKQP
A0A3Q3RXS8_BAD-02       HSKTWW-------SYLFSY-QETDGENNLHENHTPRTE-
A0A3Q3RXS8_BAD-01       HSKTWW-------SYLFSY-QETDGENNLHENHTPRTE-
A0A3Q3LME3_BMF-01       -QVGWAPETSGSLPVLLACLTLITGVW--REG-------
A0A3Q3LME3_BMF-02       QGLLWWRLATALLSLLFDR-GFIAGGG--RAGRR-----
A0A3Q3LME3_BMF-03       QGLLWWRLATALLSLLFDR-GFIAGGG--RAGRRPPCP-
                                       *:            .         

© 1998-2019