Dataset for protein Noxa of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5ZWH1_PMAIP1-      MPGKKARKNAQPSPTRAQA-------------------------------
A0A2K5ZWH1_PMAIP1-      MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHFTRGKKLVS
                        *******************                               

A0A2K5ZWH1_PMAIP1-      --------------------------------ELEVECA-----------
A0A2K5ZWH1_PMAIP1-      SSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRN
                                                        ** .* :           

A0A2K5ZWH1_PMAIP1-      -----TQLRRFGDKLNFRQKLLNLIAKLFCSGT
A0A2K5ZWH1_PMAIP1-      LTASKTCIRGLQKRLFLRRCILHKFEERLHCNW
                             * :* : ..* :*. :*: : : : .. 

© 1998-2018