Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5ZWH1_PMAIP1-      ------------------------MPGKKARKNAQPSPTRAQAELEVE--
A0A2K5ZWH1_PMAIP1-      ------------------------MPGKKARKNAQPSPTRAQAGQAGT--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z8B6_BCL2L11      -----------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ--
A0A2K5Z4C3_BMF-02       MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQ--
A0A2K5Z4C3_BMF-01       MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQ--
A0A2K5XSA1_BIK-01       --------MSGVRPISRDTLMETLLYEQLLEPLTME--------------
A0A2K5XJR2_BAD-01       --------MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAP
A0A2K5XJR2_BAD-02       --------MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAP
A0A2K5XJR2_BAD-03       --------MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAP
                                                                          

A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      ------AGTARDQAGFGIGMQLHFTRGKKLVSSSPLALPRGHEEQVQV--
A0A2K5Z8B6_BCL2L11      ------TEPQ----------------------------------------
A0A2K5Z8B6_BCL2L11      ------TEPQ----------------------------------------
A0A2K5Z8B6_BCL2L11      ------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      ------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      ------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      ------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      ------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      ------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      ------TEPQ----------------------------------------
A0A2K5Z8B6_BCL2L11      ------TEPQ----------------------------------------
A0A2K5Z4C3_BMF-02       --LFPLTH----------------------------CCGPGLRPTSQEDK
A0A2K5Z4C3_BMF-01       --LFPLTH----------------------------CCGPGLRPTSQEDK
A0A2K5XSA1_BIK-01       --VLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPR
A0A2K5XJR2_BAD-01       GLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSP
A0A2K5XJR2_BAD-02       GLLWDASHQQEQPTSSSHHGGT--------------SSPEERGHSDADAA
A0A2K5XJR2_BAD-03       GLLWDASHQQEQPTSSSHHGGGAWY-----------SPSWESEDSENPSA
                                                                          

A0A2K5ZWH1_PMAIP1-      --CATQLRRFGDKLNFRQKLLNLIAKLFCSGT------------------
A0A2K5ZWH1_PMAIP1-      --------------------ARSRVCYSTQEIWRQTELPAETSESDSQTL
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z8B6_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z8B6_BCL2L11      --------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM
A0A2K5Z4C3_BMF-02       ATQTLGPASPSQGVMLPCGVTEEPQRLF-----YAPAEPKSRVVADPPL-
A0A2K5Z4C3_BMF-01       ATQTLGPASPSQGVMLPCGVTEEPQRLF-----YGNAGYRLPLPASFPAV
A0A2K5XSA1_BIK-01       LAQLSEVAMHSLGLAFIYDQTD---DIRDVLRSFLDGFTTL-----RENI
A0A2K5XJR2_BAD-01       FRGRSRSAPPNLWAAQRYGR-----ELRRMSDEFVDSFKGLPRPKSAGTA
A0A2K5XJR2_BAD-02       KLQLDASLPVLVGSELGQG------KLRPLPVTFAPRPETPPALTVLVGH
A0A2K5XJR2_BAD-03       RMLAEASARMSAPATDSEAQLAENVKLKALGL-WRPGVATAPTPRGRRRT
                                                                          

A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      LLRNLTASKTCIRGLQKRLFLRRCILHKFEERLHCNW-------------
A0A2K5Z8B6_BCL2L11      ASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYARRLAELLASST-
A0A2K5Z8B6_BCL2L11      ASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYARRVFLNNYQAAE
A0A2K5Z8B6_BCL2L11      ASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYARRVFLNNYQAAE
A0A2K5Z8B6_BCL2L11      ASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYARRLEK-------
A0A2K5Z8B6_BCL2L11      ASRRQAEPADMRPEIRIAQELRRI-----GDEFNAYYARRMSLPPD----
A0A2K5Z8B6_BCL2L11      GIFE----------------------------------------------
A0A2K5Z8B6_BCL2L11      ANWD----------------------------------------------
A0A2K5Z8B6_BCL2L11      VREIEEVVV-----------------------------------------
A0A2K5Z8B6_BCL2L11      VVILEDIGDSSLFGFIFTGLDLYG-----HHHSQDTEQLNHKDFS-----
A0A2K5Z8B6_BCL2L11      -----DEATGSSLGIAL--------------HREVQWPLECLASS-----
A0A2K5Z4C3_BMF-02       ----PAQPCFEWRR------------------------------------
A0A2K5Z4C3_BMF-01       LPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQI
A0A2K5XSA1_BIK-01       MRFWRSPNPRSWVSREQVLLL-LALLLALLSGGLHLLLK-----------
A0A2K5XJR2_BAD-01       TQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------------
A0A2K5XJR2_BAD-02       LGYGRKCFPQASCK--------RGSVLPLSVGGLTQIPFRCM--------
A0A2K5XJR2_BAD-03       KGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------------
                                                                          

A0A2K5ZWH1_PMAIP1-      ----------------------
A0A2K5ZWH1_PMAIP1-      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      DHPQMVILRLLRYIVRLVWRMH
A0A2K5Z8B6_BCL2L11      DHPQMVILRLLRYIVRLVWRMH
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5Z4C3_BMF-02       -----------EQERGGP----
A0A2K5Z4C3_BMF-01       LLFLHNLALNGEENRNGAGPR-
A0A2K5XSA1_BIK-01       ----------------------
A0A2K5XJR2_BAD-01       ----------------------
A0A2K5XJR2_BAD-02       ----------------------
A0A2K5XJR2_BAD-03       ----------------------
                                              

© 1998-2019