Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5Z4C3_BMF-02       MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K5Z4C3_BMF-01       MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K5XSA1_BIK-01       MSGVRPISRDTLME------------------------------------
A0A2K5XJR2_BAD-01       MFQIPEFEPSEQED------------------------------------
A0A2K5XJR2_BAD-03       MFQIPEFEPSEQED------------------------------------
A0A2K5XJR2_BAD-02       MFQIPEFEPSEQED------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
A0A2K5Z8B6_BCL2L11      ------MAKQPSDV------------------------------------
                                                                          

A0A2K5ZWH1_PMAIP1-      -------MPGKKARKNAQPSP-----------------------------
A0A2K5Z4C3_BMF-02       PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA
A0A2K5Z4C3_BMF-01       PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K5XSA1_BIK-01       --TLLYEQLLEPLTME-----------------VLGVTDPEEDLDPMEDF
A0A2K5XJR2_BAD-01       --SSSAERGLGPSLAGDRPSD-CGKHHRQAPGLLWDASHQQEQPTSSSHH
A0A2K5XJR2_BAD-03       --SSSAERGLGPSLAGDRPSD-CGKHHRQAPGLLWDASHQQEQPTSSSHH
A0A2K5XJR2_BAD-02       --SSSAERGLGPSLAGDRPSD-CGKHHRQAPGLLWDASHQQEQPTSSSHH
A0A2K5ZWH1_PMAIP1-      -------MPGKKARKNAQPSP-TRAQAGQA-------GTAGTARDQAGFG
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQ-------
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQGNPEGNH
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQGNPEGNH
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQGNPEGNH
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQGNPEGNH
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQGNPEGNH
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQGNPEGNH
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQ-------
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQ-------
A0A2K5Z8B6_BCL2L11      --SSECDREGRQLQPAERPPQ-LRPGAPTS-------LQTEPQ-------
                                                                          

A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5Z4C3_BMF-02       EPKSRVV-------------------------------------------
A0A2K5Z4C3_BMF-01       GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCI----------
A0A2K5XSA1_BIK-01       DPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYD
A0A2K5XJR2_BAD-01       GGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYG
A0A2K5XJR2_BAD-03       GGGAWY-----------SPSWESEDSENPSARMLAEASARMSAPATDSEA
A0A2K5XJR2_BAD-02       GGT--------------SSPEERGHSDADAAKLQLDASLPVLVGSELGQG
A0A2K5ZWH1_PMAIP1-      IGMQLHFTRGKKLVSSSPLALPRGHEEQVQV-------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL----------
A0A2K5Z8B6_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL----------
A0A2K5Z8B6_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL----------
A0A2K5Z8B6_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL----------
A0A2K5Z8B6_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL----------
A0A2K5Z8B6_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSL----------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5ZWH1_PMAIP1-      -------------------TRAQAELEVECATQLRRFGDKLNFRQKLLNL
A0A2K5Z4C3_BMF-02       ---------------------ADPPLPAQPCFEWRREQERGGP-------
A0A2K5Z4C3_BMF-01       ---------------------------ADQFHRLHVQQHQQNRNRVWWQI
A0A2K5XSA1_BIK-01       QTD---DIRDVLRSFLDGFTTL-----RENIMRFWRSPNPRSWVSREQVL
A0A2K5XJR2_BAD-01       R-----ELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDR
A0A2K5XJR2_BAD-03       QLAENVKLKALGL-WRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPP
A0A2K5XJR2_BAD-02       ------KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQASCK-----
A0A2K5ZWH1_PMAIP1-      -------------------ARSRVCYSTQEIWRQTELPAETSESDSQTLL
A0A2K5Z8B6_BCL2L11      -------------------DRSPAPMSCD-----KSTQTPSPPCQAFNHY
A0A2K5Z8B6_BCL2L11      ------LSRSSSGYFSFDTDRSPAPMSCD-----KSTQTPSPPCQAFNHY
A0A2K5Z8B6_BCL2L11      ------LSRSSSGYFSFDTDRSPAPMSCD-----KSTQTPSPPCQAFNHY
A0A2K5Z8B6_BCL2L11      ------LSRSSSGYFSFDTDRSPAPMSCD-----KSTQTPSPPCQAFNHY
A0A2K5Z8B6_BCL2L11      ------LSRSSSGYFSFDTDRSPAPMSCD-----KSTQTPSPPCQAFNHY
A0A2K5Z8B6_BCL2L11      ------LSRSSSGYFSFDTDRSPAPMSCD-----KSTQTPSPPCQAFNHY
A0A2K5Z8B6_BCL2L11      ------LSRSSSGYFSFDTDRSPAPMSCD-----KSTQTPSPPCQAFNHY
A0A2K5Z8B6_BCL2L11      -------------------ASRRQAEPADMRPEIRIAQELRRIGDEFNAY
A0A2K5Z8B6_BCL2L11      -------------------DRSPAPMSCD-----KSTQTPSPPCQAFNHY
A0A2K5Z8B6_BCL2L11      -------------------DRSPAPMSCD-----KSTQTPSPPCQAFNHY
                                                                          

A0A2K5ZWH1_PMAIP1-      IAKLFCSGT-----------------------------------------
A0A2K5Z4C3_BMF-02       --------------------------------------------------
A0A2K5Z4C3_BMF-01       LLFLHNLALNGEENRNGAGPR-----------------------------
A0A2K5XSA1_BIK-01       LL-LALLLALLSGGLHLLLK------------------------------
A0A2K5XJR2_BAD-01       NLGRGSSAPSQ---------------------------------------
A0A2K5XJR2_BAD-03       TSGQHSVMAASSGG------------------------------------
A0A2K5XJR2_BAD-02       ---RGSVLPLSVGGLTQIPFRCM---------------------------
A0A2K5ZWH1_PMAIP1-      LRNLTASKTCIRGLQKRLFLRRCILHKFEERLHCNW--------------
A0A2K5Z8B6_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAED
A0A2K5Z8B6_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAED
A0A2K5Z8B6_BCL2L11      LSAMVREIEEVVV-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAMGIFE------------------------------------------
A0A2K5Z8B6_BCL2L11      LSAMANWD------------------------------------------
A0A2K5Z8B6_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD-----
A0A2K5Z8B6_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLEK--------
A0A2K5Z8B6_BCL2L11      YARRLAELLASST-------------------------------------
A0A2K5Z8B6_BCL2L11      LSAM-----DEATGSSLGIAL---------HREVQWPLECLASS------
A0A2K5Z8B6_BCL2L11      LSAMVVILEDIGDSSLFGFIFTGLDLYGHHHSQDTEQLNHKDFS------
                                                                          

A0A2K5ZWH1_PMAIP1-      ---------------------
A0A2K5Z4C3_BMF-02       ---------------------
A0A2K5Z4C3_BMF-01       ---------------------
A0A2K5XSA1_BIK-01       ---------------------
A0A2K5XJR2_BAD-01       ---------------------
A0A2K5XJR2_BAD-03       ---------------------
A0A2K5XJR2_BAD-02       ---------------------
A0A2K5ZWH1_PMAIP1-      ---------------------
A0A2K5Z8B6_BCL2L11      HPQMVILRLLRYIVRLVWRMH
A0A2K5Z8B6_BCL2L11      HPQMVILRLLRYIVRLVWRMH
A0A2K5Z8B6_BCL2L11      ---------------------
A0A2K5Z8B6_BCL2L11      ---------------------
A0A2K5Z8B6_BCL2L11      ---------------------
A0A2K5Z8B6_BCL2L11      ---------------------
A0A2K5Z8B6_BCL2L11      ---------------------
A0A2K5Z8B6_BCL2L11      ---------------------
A0A2K5Z8B6_BCL2L11      ---------------------
A0A2K5Z8B6_BCL2L11      ---------------------
                                             

© 1998-2018