Dataset for protein Bad of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5XJR2_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5XJR2_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5XJR2_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
                       **************************************************

A0A2K5XJR2_BAD-01      QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
A0A2K5XJR2_BAD-03      QQEQPTSSSHHGGGAWY-----------SPSWESEDSENPSARMLAEASA
A0A2K5XJR2_BAD-02      QQEQPTSSSHHGGT--------------SSPEERGHSDADAAKLQLDASL
                       *************               ..  :   .:  :.    . * 

A0A2K5XJR2_BAD-01      PPNLWAAQRYGR-----ELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSS
A0A2K5XJR2_BAD-03      RMSAPATDSEAQLAENVKLKALGL-WRPGVATAPTPRGRRRTKGWRRSPA
A0A2K5XJR2_BAD-02      PVLVGSELGQG------KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCF
                            :    .      :*. :   :       *            ..  

A0A2K5XJR2_BAD-01      WTRVFQSWWDRNLGRGSSAPSQ------------
A0A2K5XJR2_BAD-03      PFGAARAPRPPTSGQHSVMAASSGG---------
A0A2K5XJR2_BAD-02      PQASCK--------RGSVLPLSVGGLTQIPFRCM
                            .        . *  . .            

© 1998-2019