Dataset for protein Bad of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5XJR2_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5XJR2_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5XJR2_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
                       **************************************************

A0A2K5XJR2_BAD-02      QQEQPTSSSHHGG-------------------------------TSSPEE
A0A2K5XJR2_BAD-03      QQEQPTSSSHHGGGAWYSPSWESEDSENPSARMLAEASARMSAPATDSEA
A0A2K5XJR2_BAD-01      QQEQPTSSSHHGG-----------------AGAVETRSRHSSYPAGTEED
                       *************                               :   * 

A0A2K5XJR2_BAD-02      R---------------GHSDADAA-KLQLDASLPVLVGSELGQGKLRPLP
A0A2K5XJR2_BAD-03      QLAENVKLKALGLWRPGVATAPTP-RGRRRT------------KGWRRSP
A0A2K5XJR2_BAD-01      E---------------GMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMS
                                       *     :. . .  :               *  .

A0A2K5XJR2_BAD-02      VTF------APRPETPPALTVLVGHLGYGR--KCFPQASCKRGSVLPLSV
A0A2K5XJR2_BAD-03      APF--GAARAPRPPTSGQHSVMAASSGG----------------------
A0A2K5XJR2_BAD-01      DEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-
                         *       *** :.   : :    .                       

A0A2K5XJR2_BAD-02      GGLTQIPFRCM
A0A2K5XJR2_BAD-03      -----------
A0A2K5XJR2_BAD-01      -----------
                                  

© 1998-2018