Dataset for protein Noxa of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6BV75_PMAIP1-      MPGKKARKNAQPSPTRAQAGPAGTAGTARDQAGFGIGMQLHYTRGKKLVS
A0A2K6BV75_PMAIP1-      MPGKKARKNAQPSPTRAQA-------------------------------
                        *******************                               

A0A2K6BV75_PMAIP1-      SSPLVLPRGHEEQVQVARSRVCYSTQEIWRQTKLPAETSESDSQTLLLRN
A0A2K6BV75_PMAIP1-      ----------ELEVECA---------------------------------
                                  * :*: *                                 

A0A2K6BV75_PMAIP1-      LTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW
A0A2K6BV75_PMAIP1-      -----TQLRRFGDKLNFRQKLLNLIAKLFCSGT
                             * :* : ..* :*.  *: : : : .. 

© 1998-2019