Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6BV75_PMAIP1-      ------------------------------------MPGKKARKNAQPS-
A0A2K6AYL7_HRK-01       -------------MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAAR-
A0A2K6B5G4_BMF-03       -------------MEPSRCVEE--------LEDDVFQPEDGEPGAQPGSS
A0A2K6B5G4_BMF-02       -------------MEPSRCVEE--------LEDDVFQPEDGEPGAQPGSS
A0A2K6B5G4_BMF-01       -------------MEPSRCVEE--------LEDDVFQPEDGEPGAQPGSS
A0A2K6B5G4_BMF-04       -------------MEPSRCVEE--------LEDDVFQPEDGEPGAQPGSS
A0A2K6ASP2_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSA-
A0A2K6DBJ4_BIK-01       -----------MSGVRPISRDT------LM---------ETLLYEQLLE-
A0A2K6E7J3_BAD-01       -----------MFQIPEFEPSE------QE---------DSSSAERGLG-
A0A2K6E7J3_BAD-02       -----------MFQIPEFEPSE------QE---------DSSSAERGLG-
A0A2K6E7J3_BAD-03       -----------MFQIPEFEPSE------QE---------DSSSAERGLG-
A0A2K6BV75_PMAIP1-      ------------------------------------MPGKKARKNAQPS-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
                                                               .          

A0A2K6BV75_PMAIP1-      --------------------------------PTRAQAELEVECATQLRR
A0A2K6AYL7_HRK-01       --------------------------------LKALGDELHQRTMWRRRA
A0A2K6B5G4_BMF-03       LSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPS
A0A2K6B5G4_BMF-02       LSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPS
A0A2K6B5G4_BMF-01       LSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPS
A0A2K6B5G4_BMF-04       LSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPS
A0A2K6ASP2_BBC3-03      --------------------------------PGALAGGPTQAAPGVRGE
A0A2K6DBJ4_BIK-01       --------------------------------PLTME-------------
A0A2K6E7J3_BAD-01       --------------------------------PSPAGDRPSDSGKHHRQA
A0A2K6E7J3_BAD-02       --------------------------------PSPAGDRPSDSGKHHRQA
A0A2K6E7J3_BAD-03       --------------------------------PSPAGDRPSDSGKHHRQA
A0A2K6BV75_PMAIP1-      --------------------------------PTRAQAGPAGTAGTARDQ
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQ---------
A0A2K6E226_BCL2L11      --------------------------------PTSLQTDP----------
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQ---------
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
                                                                          

A0A2K6BV75_PMAIP1-      FGDKLNFRQKLLNLIAKLFCSGT---------------------------
A0A2K6AYL7_HRK-01       RSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL-------------
A0A2K6B5G4_BMF-03       QGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL-----------------
A0A2K6B5G4_BMF-02       QGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPI-------------
A0A2K6B5G4_BMF-01       QGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPI-------------
A0A2K6B5G4_BMF-04       QGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPI-------------
A0A2K6ASP2_BBC3-03      EEQWAREIGAQLRRMADDLNAQYERRRQ----------------------
A0A2K6DBJ4_BIK-01       ---VLGVTDPEEDLDPMEDF------DPLECIEDSDMLALRLACIGDEMD
A0A2K6E7J3_BAD-01       PGLLWDASHQQEQPTSSSHHGGA---GAVETRSRHSSYPAGT-----EED
A0A2K6E7J3_BAD-02       PGLLWDASHQQEQPTSSSHHGGT---SSPEERGHSDADAAKL-----QLD
A0A2K6E7J3_BAD-03       PGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPSARM-----LAE
A0A2K6BV75_PMAIP1-      AG--------------------FGIGMQLHYTRGKKLV------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------GPFATRSP----------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
A0A2K6B5G4_BMF-03       ----------------PAQPCFEWRR------------------------
A0A2K6B5G4_BMF-02       ---------------GEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQ
A0A2K6B5G4_BMF-01       ---------------GEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQ
A0A2K6B5G4_BMF-04       ---------------GEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQ
A0A2K6ASP2_BBC3-03      ---------EEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN-----
A0A2K6DBJ4_BIK-01       VSLRAPRLAQLSEVAMHSLGLAFIYDQMDDI----RDVLRSFMDGFTTL-
A0A2K6E7J3_BAD-01       EGMEEEPSPFRGRSRSAPPNLWAAQRYGREL----RRMSDEFVDSFKGLP
A0A2K6E7J3_BAD-02       ASLPVLVGSELGQG---------------KL----RTLPVTFAPRPETPP
A0A2K6E7J3_BAD-03       ASARMSAPATDSEAQHAE---------NVKL----KALGL-WRPAVATAP
A0A2K6BV75_PMAIP1-      ---SSSPLVLPRGHEEQVQVARSRVCYSTQEIWRQTKLPAETSESDSQTL
A0A2K6E226_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------------
A0A2K6E226_BCL2L11      ---------CDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
                                                                          

A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
A0A2K6B5G4_BMF-03       -----------------------EQERGGP--------------------
A0A2K6B5G4_BMF-02       HQQNRNRVWWQILLFLHNLALNGEENRNGAGPR-----------------
A0A2K6B5G4_BMF-01       HQQNRNRVWWQILLFLHNLALNGEENRNGAGPR-----------------
A0A2K6B5G4_BMF-04       HQQNRNRVWWQILLFLHNLALNGEENRNGAGPR-----------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2K6DBJ4_BIK-01       ----RENIMRFWRSPNPRSWVS--------REQVLLVLLLLLALLLALLS
A0A2K6E7J3_BAD-01       RPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSA-----------PSQ-
A0A2K6E7J3_BAD-02       ALTVLVGHLGYGRKCFPQALCK--------RGSVL-----------PLSV
A0A2K6E7J3_BAD-03       TPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVM-----------AASS
A0A2K6BV75_PMAIP1-      LLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHC-----------NW--
A0A2K6E226_BCL2L11      -LEDIGDSSLWFGFIFTGLDLYGHHHSQDTEQLNH-----------KDFS
A0A2K6E226_BCL2L11      ELRRIGDE--FNAYYARRVFLNNYQAAEDHPQMVI-----------LRLL
A0A2K6E226_BCL2L11      ELRRIGDE--FNAYYARRVFLNNYQAAEDHPQMVI-----------LRLL
A0A2K6E226_BCL2L11      ELRRIGDE--FNAYYARRVFLNNYQAAEDHPQMVI-----------LRLL
A0A2K6E226_BCL2L11      ELRRIGDE--FNAYYARRVFLNNYQAAEDHPQMVI-----------LRLL
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      ELRRIGDE--FNAYYARRMSLPPD--------------------------
A0A2K6E226_BCL2L11      ELRRIGDE--FNAYYARRLEK-----------------------------
                                                                          

A0A2K6BV75_PMAIP1-      -----------
A0A2K6AYL7_HRK-01       -----------
A0A2K6B5G4_BMF-03       -----------
A0A2K6B5G4_BMF-02       -----------
A0A2K6B5G4_BMF-01       -----------
A0A2K6B5G4_BMF-04       -----------
A0A2K6ASP2_BBC3-03      -----------
A0A2K6DBJ4_BIK-01       GGLHLLLK---
A0A2K6E7J3_BAD-01       -----------
A0A2K6E7J3_BAD-02       GGLTQIPFRCM
A0A2K6E7J3_BAD-03       GG---------
A0A2K6BV75_PMAIP1-      -----------
A0A2K6E226_BCL2L11      -----------
A0A2K6E226_BCL2L11      RYIVRLVWRMH
A0A2K6E226_BCL2L11      RYIVRLVWRMH
A0A2K6E226_BCL2L11      RYIVRLVWRMH
A0A2K6E226_BCL2L11      RYIVRLVWRMH
A0A2K6E226_BCL2L11      -----------
A0A2K6E226_BCL2L11      -----------
A0A2K6E226_BCL2L11      -----------
A0A2K6E226_BCL2L11      -----------
A0A2K6E226_BCL2L11      -----------
                                   

© 1998-2018