Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6BV75_PMAIP1-      ------------------------------------MPGKKARKNAQPS-
A0A2K6AYL7_HRK-01       -------------MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAAR-
A0A2K6B5G4_BMF-04       -------------MEPSRCVEE--------LEDDVFQPEDGEPGAQPGSS
A0A2K6B5G4_BMF-02       -------------MEPSRCVEE--------LEDDVFQPEDGEPGAQPGSS
A0A2K6B5G4_BMF-01       -------------MEPSRCVEE--------LEDDVFQPEDGEPGAQPGSS
A0A2K6B5G4_BMF-03       -------------MEPSRCVEE--------LEDDVFQPEDGEPGAQPGSS
A0A2K6ASP2_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSA-
A0A2K6DBJ4_BIK-01       -----------MSGVRPISRDT------LM---------ETLLYEQLLE-
A0A2K6E7J3_BAD-01       -----------MFQIPEFEPSE------QE---------DSSSAERGLG-
A0A2K6E7J3_BAD-02       -----------MFQIPEFEPSE------QE---------DSSSAERGLG-
A0A2K6E7J3_BAD-03       -----------MFQIPEFEPSE------QE---------DSSSAERGLG-
A0A2K6BV75_PMAIP1-      ------------------------------------MPGKKARKNAQPS-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
A0A2K6E226_BCL2L11      -----------MAKQPSDVSSE------CDREGRQLQPAERPPQLRPGA-
                                                               .          

A0A2K6BV75_PMAIP1-      --------------------------------PTRAQAE-----------
A0A2K6AYL7_HRK-01       --------------------------------LKALGDELHQRTMWRRRA
A0A2K6B5G4_BMF-04       LSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPS
A0A2K6B5G4_BMF-02       LSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPS
A0A2K6B5G4_BMF-01       LSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPS
A0A2K6B5G4_BMF-03       LSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPS
A0A2K6ASP2_BBC3-03      --------------------------------PGALAGGPTQAAPGVRGE
A0A2K6DBJ4_BIK-01       --------------------------------PLTME-------------
A0A2K6E7J3_BAD-01       --------------------------------PSPAGDRPSDSGKHHRQA
A0A2K6E7J3_BAD-02       --------------------------------PSPAGDRPSDSGKHHRQA
A0A2K6E7J3_BAD-03       --------------------------------PSPAGDRPSDSGKHHRQA
A0A2K6BV75_PMAIP1-      --------------------------------PTRAQAGPAGTAGTARDQ
A0A2K6E226_BCL2L11      --------------------------------PTSLQTDP----------
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQ---------
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQ---------
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
A0A2K6E226_BCL2L11      --------------------------------PTSLQTEPQGNPEGNHGG
                                                                          

A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6AYL7_HRK-01       RSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL-------------
A0A2K6B5G4_BMF-04       QGVMLPCGVTEEPQRLFYGNAGYRLPLP----------------------
A0A2K6B5G4_BMF-02       QGVMLPCGVTEEPQRLFYGNAGYRLPLP----------------------
A0A2K6B5G4_BMF-01       QGVMLPCGVTEEPQRLFYGNAGYRLPLP----------------------
A0A2K6B5G4_BMF-03       QGVMLPCGVTEEPQRLFYAPAEPKSRVV----------------------
A0A2K6ASP2_BBC3-03      EEQWAREIGAQLRRMADDLNAQYERRRQ----------------------
A0A2K6DBJ4_BIK-01       ---VLGVTDPEEDLDPMEDF------DPLECIEDSDMLALRLACIGDEMD
A0A2K6E7J3_BAD-01       PGLLWDASHQQEQPTSSSHHGGA---GAVETRSRHSSYPAGT-----EED
A0A2K6E7J3_BAD-02       PGLLWDASHQQEQPTSSSHHGGT---SSPEERGHSDADAAKL-----QLD
A0A2K6E7J3_BAD-03       PGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPSARM-----LAE
A0A2K6BV75_PMAIP1-      AGFGI-------GMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYS
A0A2K6E226_BCL2L11      --------------------GPFATRSP----------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K6E226_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A2K6BV75_PMAIP1-      -----LEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT-----------
A0A2K6AYL7_HRK-01       --------------------------------------------------
A0A2K6B5G4_BMF-04       -----ASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQH
A0A2K6B5G4_BMF-02       -----ASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQH
A0A2K6B5G4_BMF-01       -----ASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQH
A0A2K6B5G4_BMF-03       -----ADPPL-----PAQPCFEWRR-------------------------
A0A2K6ASP2_BBC3-03      ---------EEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN-----
A0A2K6DBJ4_BIK-01       VSLRAPRLAQLSEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTL-----
A0A2K6E7J3_BAD-01       EGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKS
A0A2K6E7J3_BAD-02       ASLPVLVGSELGQG---------------KLRTLPVTFAPRPETPPALTV
A0A2K6E7J3_BAD-03       ASARMSAPATDSEAQHAE---------NVKLKALGL-WRPAVATAPTPRG
A0A2K6BV75_PMAIP1-      TQEIWRQTKLPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQ
A0A2K6E226_BCL2L11      ---------CDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDSSLWFGFIFT
A0A2K6E226_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K6E226_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
                                                                          

A0A2K6BV75_PMAIP1-      --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
A0A2K6B5G4_BMF-04       QQNRNRVWWQILLFLHNLALNGEENRNGAGPR------------------
A0A2K6B5G4_BMF-02       QQNRNRVWWQILLFLHNLALNGEENRNGAGPR------------------
A0A2K6B5G4_BMF-01       QQNRNRVWWQILLFLHNLALNGEENRNGAGPR------------------
A0A2K6B5G4_BMF-03       ----------------------EQERGGP---------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2K6DBJ4_BIK-01       RENIMRFWRSPNPRSWVS--------REQVLLVLLLLLALLLALLSGGLH
A0A2K6E7J3_BAD-01       AGTATQMRQSSSWTRVFQSWWDRNLGRGSS-----------APSQ-----
A0A2K6E7J3_BAD-02       LVGHLGYGRKCFPQALCK--------RGSV-----------LPLSVGGLT
A0A2K6E7J3_BAD-03       RRRTKGWRRSPAPFGAARAPRPPTSGQHSV-----------MAASSGG--
A0A2K6BV75_PMAIP1-      FEERLHCNW-----------------------------------------
A0A2K6E226_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K6E226_BCL2L11      GLDLYGHHHSQDTEQLNHKDFS----------------------------
A0A2K6E226_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K6E226_BCL2L11      ELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K6E226_BCL2L11      ELRRIGDEFNAYYARRMSLPPD----------------------------
A0A2K6E226_BCL2L11      ELRRIGDEFNAYYARRLEK-------------------------------
                                                                          

A0A2K6BV75_PMAIP1-      -------
A0A2K6AYL7_HRK-01       -------
A0A2K6B5G4_BMF-04       -------
A0A2K6B5G4_BMF-02       -------
A0A2K6B5G4_BMF-01       -------
A0A2K6B5G4_BMF-03       -------
A0A2K6ASP2_BBC3-03      -------
A0A2K6DBJ4_BIK-01       LLLK---
A0A2K6E7J3_BAD-01       -------
A0A2K6E7J3_BAD-02       QIPFRCM
A0A2K6E7J3_BAD-03       -------
A0A2K6BV75_PMAIP1-      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
A0A2K6E226_BCL2L11      -------
                               

© 1998-2019